BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0518 (455 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCP1E11.03 |mug170||arrestin|Schizosaccharomyces pombe|chr 3|||... 27 1.0 SPCC548.06c |ght8||hexose transporter Ght8 |Schizosaccharomyces ... 26 3.1 >SPCP1E11.03 |mug170||arrestin|Schizosaccharomyces pombe|chr 3|||Manual Length = 426 Score = 27.5 bits (58), Expect = 1.0 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = -3 Query: 294 LEFANQVLAIVSLEVSAISRRCTMPRRQSTSM 199 L + + L + SL+ + RCT+P+R TSM Sbjct: 212 LYYISSTLTLTSLDQNIRCTRCTIPKRVITSM 243 >SPCC548.06c |ght8||hexose transporter Ght8 |Schizosaccharomyces pombe|chr 3|||Manual Length = 547 Score = 25.8 bits (54), Expect = 3.1 Identities = 12/46 (26%), Positives = 22/46 (47%) Frame = +2 Query: 179 GTDEKAIIDVLCRRGIVQRLEIAETSRLTMART*LANSRVNSPATW 316 G DE+A+ D++C+ ++ R + + +T PATW Sbjct: 210 GKDEEAL-DIMCKNNVLPREHEIIQTEYHVIKTDCEAEMAGGPATW 254 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,591,758 Number of Sequences: 5004 Number of extensions: 26432 Number of successful extensions: 72 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 72 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 72 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 170285640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -