BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0518 (455 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g38760.1 68415.m04759 annexin 3 (ANN3) nearly identical to an... 40 8e-04 At5g12380.1 68418.m01456 annexin, putative similar to annexin [F... 32 0.16 At5g10230.1 68418.m01187 annexin 7 (ANN7) nearly identical to ca... 32 0.16 At5g10220.1 68418.m01185 annexin 6 (ANN6) nearly identical to ca... 32 0.16 At1g70950.1 68414.m08185 expressed protein 30 0.65 At1g68090.1 68414.m07778 annexin 5 (ANN5) identical to calcium-b... 30 0.65 At1g76270.1 68414.m08856 expressed protein contains Pfam PF03138... 29 1.5 At1g54460.1 68414.m06212 expressed protein 28 2.6 At5g45230.1 68418.m05551 disease resistance protein (TIR-NBS-LRR... 27 4.5 At2g41640.1 68415.m05145 expressed protein contains Pfam domain,... 27 4.5 At1g17980.2 68414.m02224 nucleotidyltransferase family protein c... 27 4.5 At1g17980.1 68414.m02225 nucleotidyltransferase family protein c... 27 4.5 At4g32330.2 68417.m04600 expressed protein 27 6.0 At4g32330.1 68417.m04599 expressed protein 27 6.0 At4g19900.1 68417.m02916 glycosyl transferase-related contains P... 27 6.0 At3g47680.1 68416.m05192 expressed protein contains similarity t... 27 6.0 At4g28710.1 68417.m04106 myosin heavy chain, putative similar to... 27 7.9 At3g12200.1 68416.m01521 protein kinase family protein contains ... 27 7.9 At2g20010.1 68415.m02339 expressed protein 27 7.9 At1g20550.1 68414.m02561 expressed protein contains Pfam PF03138... 27 7.9 >At2g38760.1 68415.m04759 annexin 3 (ANN3) nearly identical to annexin (AnnAt3) [Arabidopsis thaliana] GI:6503082; contains Pfam profile PF00191: Annexin Length = 321 Score = 39.9 bits (89), Expect = 8e-04 Identities = 20/36 (55%), Positives = 28/36 (77%) Frame = +2 Query: 152 TLRKAMKGFGTDEKAIIDVLCRRGIVQRLEIAETSR 259 TL++A++G+GTDEKAII VL +R QR +I E+ R Sbjct: 19 TLKQAIRGWGTDEKAIIRVLGQRDQSQRRKIRESFR 54 Score = 29.9 bits (64), Expect = 0.85 Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +1 Query: 205 RALPPRHRATPRD-RGDLKTNYGKDLISELKSELTGNLENVIVA 333 R L R ++ R R + YGKDLI L SEL+G+ +V+ Sbjct: 36 RVLGQRDQSQRRKIRESFREIYGKDLIDVLSSELSGDFMKAVVS 79 Score = 26.6 bits (56), Expect = 7.9 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +3 Query: 336 DDSPAPLLR*RSSTDAVSGIGTDEEAIIEIL 428 ++ P+P + A+ G GTDE+AII +L Sbjct: 8 NEVPSPAQDSETLKQAIRGWGTDEKAIIRVL 38 >At5g12380.1 68418.m01456 annexin, putative similar to annexin [Fragaria x ananassa] GI:6010777, annexin p33 [Zea mays] GI:6272285; contains Pfam profile PF00191: Annexin Length = 316 Score = 32.3 bits (70), Expect = 0.16 Identities = 21/59 (35%), Positives = 28/59 (47%) Frame = +1 Query: 265 YGKDLISELKSELTGNLENVIVALMTPLPHFYAKGAPPMLSQELEPTKKPSSRSCARFP 441 Y +DLI +LKSEL+GN E I + P A A L + + K +C R P Sbjct: 56 YHEDLIHQLKSELSGNFERAICLWVLDPPERDALLANLALQKPIPDYKVLVEIACMRSP 114 Score = 29.5 bits (63), Expect = 1.1 Identities = 12/27 (44%), Positives = 19/27 (70%) Frame = +2 Query: 155 LRKAMKGFGTDEKAIIDVLCRRGIVQR 235 ++ A +G+GT+E AII +L R + QR Sbjct: 19 IKAACQGWGTNENAIISILGHRNLFQR 45 >At5g10230.1 68418.m01187 annexin 7 (ANN7) nearly identical to calcium-binding protein annexin 7 [Arabidopsis thaliana] GI:12667522 Length = 316 Score = 32.3 bits (70), Expect = 0.16 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = +2 Query: 155 LRKAMKGFGTDEKAIIDVLCRRGIVQR 235 L KA KG+GT+E+ II +L R QR Sbjct: 20 LYKAFKGWGTNERMIISILAHRNATQR 46 Score = 30.3 bits (65), Expect = 0.65 Identities = 17/39 (43%), Positives = 22/39 (56%), Gaps = 3/39 (7%) Frame = +1 Query: 223 HR-ATPRD--RGDLKTNYGKDLISELKSELTGNLENVIV 330 HR AT R R NY KDL+ EL EL+G+ E ++ Sbjct: 40 HRNATQRSFIRAVYAANYNKDLLKELDRELSGDFERAVM 78 >At5g10220.1 68418.m01185 annexin 6 (ANN6) nearly identical to calcium-binding protein annexin 6 [Arabidopsis thaliana] GI:12667518 Length = 318 Score = 32.3 bits (70), Expect = 0.16 Identities = 18/39 (46%), Positives = 23/39 (58%), Gaps = 3/39 (7%) Frame = +1 Query: 223 HR-ATPRD--RGDLKTNYGKDLISELKSELTGNLENVIV 330 HR AT R R NY KDL+ EL EL+G+ E V++ Sbjct: 40 HRNATQRSFIRAVYAANYNKDLLKELDGELSGDFERVVM 78 Score = 31.5 bits (68), Expect = 0.28 Identities = 14/27 (51%), Positives = 17/27 (62%) Frame = +2 Query: 155 LRKAMKGFGTDEKAIIDVLCRRGIVQR 235 L KA KG+GT+E II +L R QR Sbjct: 20 LHKAFKGWGTNEGMIISILAHRNATQR 46 >At1g70950.1 68414.m08185 expressed protein Length = 478 Score = 30.3 bits (65), Expect = 0.65 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +1 Query: 340 TPLPHFYAKGAPPMLSQELEPTKKPSSRS 426 TP+P FY G P+ + EP+K SRS Sbjct: 384 TPMPSFYNIGTRPVSHNKTEPSKVAQSRS 412 >At1g68090.1 68414.m07778 annexin 5 (ANN5) identical to calcium-binding protein annexin 5 [Arabidopsis thaliana] GI:12667520 Length = 316 Score = 30.3 bits (65), Expect = 0.65 Identities = 13/25 (52%), Positives = 18/25 (72%) Frame = +2 Query: 155 LRKAMKGFGTDEKAIIDVLCRRGIV 229 LRK+MKG GTD+ A+I ++ R V Sbjct: 251 LRKSMKGLGTDDTALIRIVVTRAEV 275 Score = 27.9 bits (59), Expect = 3.4 Identities = 11/32 (34%), Positives = 21/32 (65%) Frame = +2 Query: 155 LRKAMKGFGTDEKAIIDVLCRRGIVQRLEIAE 250 L+++++G TD KAI +++C R Q +I + Sbjct: 92 LKRSLRGAVTDHKAIAEIICTRSGSQLRQIKQ 123 Score = 27.9 bits (59), Expect = 3.4 Identities = 10/32 (31%), Positives = 20/32 (62%) Frame = +1 Query: 244 RGDLKTNYGKDLISELKSELTGNLENVIVALM 339 R ++ YGK+L ++ E GN E+V++ ++ Sbjct: 206 RSTYRSMYGKELGKAIRDETRGNFEHVLLTIL 237 >At1g76270.1 68414.m08856 expressed protein contains Pfam PF03138: Plant protein family. The function of this family of plant proteins is unknown; previously annotated as ' auxin-independent growth promoter -related' based on similarity to axi 1 protein (GB:X80301) (GI:559920) from [Nicotiana tabacum], which, due to scienitific fraud was retracted. Retraction in: Schell J. EMBO J 1999 May 17;18(10):2908. PMID:10400497. Length = 572 Score = 29.1 bits (62), Expect = 1.5 Identities = 21/57 (36%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = +1 Query: 265 YGKDL-ISELKSELTGNLENVIVALMTPLPHFYAKGAPPMLSQELEPTKKPSSRSCA 432 YG D+ I E+ G E+ + L PHFY+K +ELEP SSR A Sbjct: 339 YGSDVHIYVASGEVYGGEES-LAPLKALFPHFYSKDT-IATKEELEPFSSYSSRMAA 393 >At1g54460.1 68414.m06212 expressed protein Length = 338 Score = 28.3 bits (60), Expect = 2.6 Identities = 14/52 (26%), Positives = 23/52 (44%) Frame = +1 Query: 280 ISELKSELTGNLENVIVALMTPLPHFYAKGAPPMLSQELEPTKKPSSRSCAR 435 + E + +T L + P+P FY +G PP + P +P S + R Sbjct: 201 LKEEQEAVTKQLRKNMAYKANPVPSFYQEGPPPKQPLKKFPLTRPKSPNLNR 252 >At5g45230.1 68418.m05551 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1231 Score = 27.5 bits (58), Expect = 4.5 Identities = 14/35 (40%), Positives = 16/35 (45%) Frame = +2 Query: 341 LPCPTFTLKELHRCCLRNWNRRRSHHRDPVHAFQL 445 LPC F L L R CL + R+ D H F L Sbjct: 834 LPCSIFHLSSLRRLCLSRNDNIRTLRFDMGHMFHL 868 >At2g41640.1 68415.m05145 expressed protein contains Pfam domain, PF04577: Protein of unknown function (DUF563) Length = 500 Score = 27.5 bits (58), Expect = 4.5 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = -2 Query: 76 SAHVEILLFNSDTPNHTRPERI 11 SA I LF S T N+T+PE+I Sbjct: 121 SASSSIFLFTSSTNNNTKPEKI 142 >At1g17980.2 68414.m02224 nucleotidyltransferase family protein contains Pfam profiles: PF01909 nucleotidyltransferase domain, PF04926 poly(A) polymerase predicted RNA binding domain Length = 586 Score = 27.5 bits (58), Expect = 4.5 Identities = 12/34 (35%), Positives = 22/34 (64%) Frame = -3 Query: 303 EFTLEFANQVLAIVSLEVSAISRRCTMPRRQSTS 202 E + +F NQV+ +S +V+ +S T+P ++TS Sbjct: 504 EESFDFGNQVIEQISHKVAVLSATATIPPFEATS 537 >At1g17980.1 68414.m02225 nucleotidyltransferase family protein contains Pfam profiles: PF01909 nucleotidyltransferase domain, PF04926 poly(A) polymerase predicted RNA binding domain Length = 713 Score = 27.5 bits (58), Expect = 4.5 Identities = 12/34 (35%), Positives = 22/34 (64%) Frame = -3 Query: 303 EFTLEFANQVLAIVSLEVSAISRRCTMPRRQSTS 202 E + +F NQV+ +S +V+ +S T+P ++TS Sbjct: 631 EESFDFGNQVIEQISHKVAVLSATATIPPFEATS 664 >At4g32330.2 68417.m04600 expressed protein Length = 436 Score = 27.1 bits (57), Expect = 6.0 Identities = 12/35 (34%), Positives = 16/35 (45%) Frame = +1 Query: 340 TPLPHFYAKGAPPMLSQELEPTKKPSSRSCARFPT 444 TP+P FY + PP + P +P S R T Sbjct: 262 TPMPSFYQEPQPPKTELKKIPPTRPKSPKLGRKKT 296 >At4g32330.1 68417.m04599 expressed protein Length = 437 Score = 27.1 bits (57), Expect = 6.0 Identities = 12/35 (34%), Positives = 16/35 (45%) Frame = +1 Query: 340 TPLPHFYAKGAPPMLSQELEPTKKPSSRSCARFPT 444 TP+P FY + PP + P +P S R T Sbjct: 263 TPMPSFYQEPQPPKTELKKIPPTRPKSPKLGRKKT 297 >At4g19900.1 68417.m02916 glycosyl transferase-related contains Pfam profiles PF01535: PPR repeat, PF04572: Alpha 1,4-glycosyltransferase conserved region, PF04488: Glycosyltransferase sugar-binding region containing DXD motif; several hypothetical proteins - Arabidopsis thaliana Length = 1302 Score = 27.1 bits (57), Expect = 6.0 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 5/46 (10%) Frame = -2 Query: 145 IRGRVERLRGVHRGGALVRVVLLSAHVEIL-----LFNSDTPNHTR 23 +R R R R + A++ VLL A V +L LF+S +PNH R Sbjct: 2 LRSRRSRSRHGAQACAVMSAVLLLASVSLLYTRLSLFSSHSPNHLR 47 >At3g47680.1 68416.m05192 expressed protein contains similarity to hypothetical proteins of [Arabidopsis thaliana] Length = 302 Score = 27.1 bits (57), Expect = 6.0 Identities = 22/66 (33%), Positives = 34/66 (51%), Gaps = 8/66 (12%) Frame = -3 Query: 348 QGSHQCDDDIFQVA--------GEFTLEFANQVLAIVSLEVSAISRRCTMPRRQSTSMIA 193 + S Q DDD+ +A G+FTLE A +VL +SA S + T+ ++ S A Sbjct: 130 KSSGQNDDDVVALAHEIYNSEHGKFTLEHAWRVLRFEQKWLSAPSTKATVMSKRRKSDKA 189 Query: 192 FSSVPK 175 +S P+ Sbjct: 190 STSQPQ 195 >At4g28710.1 68417.m04106 myosin heavy chain, putative similar to myosin [Arabidopsis thaliana] gi|499047|emb|CAA84066. Length = 899 Score = 26.6 bits (56), Expect = 7.9 Identities = 14/29 (48%), Positives = 19/29 (65%) Frame = +2 Query: 155 LRKAMKGFGTDEKAIIDVLCRRGIVQRLE 241 L+ A + F DE+A+ D LC+R IV R E Sbjct: 353 LKTAAELFMCDEQALEDSLCKRVIVTRGE 381 >At3g12200.1 68416.m01521 protein kinase family protein contains protein kinase domain, Pfam:PF00069; contains serine/threonine protein kinase domain, INTERPRO:IPR002290 Length = 571 Score = 26.6 bits (56), Expect = 7.9 Identities = 13/34 (38%), Positives = 22/34 (64%), Gaps = 3/34 (8%) Frame = +1 Query: 232 TPRD---RGDLKTNYGKDLISELKSELTGNLENV 324 +P+D R L +GK+ +S KSE++ +LEN+ Sbjct: 298 SPKDKARRNSLPGKFGKERVSREKSEVSRSLENL 331 >At2g20010.1 68415.m02339 expressed protein Length = 834 Score = 26.6 bits (56), Expect = 7.9 Identities = 15/41 (36%), Positives = 20/41 (48%), Gaps = 2/41 (4%) Frame = +2 Query: 158 RKAMKGFGTDEKAIIDVLCRRGIVQ--RLEIAETSRLTMAR 274 RK+ G G D I+ CR +Q R EI + R T+ R Sbjct: 567 RKSQLGTGNDSAEILQFCCRINTLQYIRTEIESSGRKTLNR 607 >At1g20550.1 68414.m02561 expressed protein contains Pfam PF03138: Plant protein family. The function of this family of plant proteins is unknown; previously annotated as 'axi 1 protein -related' based on similarity to axi 1 protein (GB:X80301) (GI:559920) from [Nicotiana tabacum], which, due to scienitific fraud was retracted. Retraction in: Schell J. EMBO J 1999 May 17;18(10):2908. PMID:10400497. Length = 526 Score = 26.6 bits (56), Expect = 7.9 Identities = 20/57 (35%), Positives = 25/57 (43%), Gaps = 1/57 (1%) Frame = +1 Query: 265 YGKDL-ISELKSELTGNLENVIVALMTPLPHFYAKGAPPMLSQELEPTKKPSSRSCA 432 YG D+ I E+ G E + L PHFY+K EL+P SSR A Sbjct: 304 YGSDVHIYVASGEVYGG-EKSLAPLKALFPHFYSKDT-IATKMELKPFSSYSSRMAA 358 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,649,863 Number of Sequences: 28952 Number of extensions: 150121 Number of successful extensions: 508 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 474 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 508 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 752336160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -