BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0515 (474 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q7RJE3 Cluster: Mus musculus GCN2alpha; n=9; Plasmodium... 33 2.4 UniRef50_Q2FPP5 Cluster: Putative uncharacterized protein precur... 33 4.3 UniRef50_UPI0000E480D1 Cluster: PREDICTED: hypothetical protein,... 32 5.6 UniRef50_A5E4U2 Cluster: Putative uncharacterized protein; n=1; ... 32 5.6 UniRef50_A0DMX7 Cluster: Chromosome undetermined scaffold_57, wh... 31 9.8 >UniRef50_Q7RJE3 Cluster: Mus musculus GCN2alpha; n=9; Plasmodium (Vinckeia)|Rep: Mus musculus GCN2alpha - Plasmodium yoelii yoelii Length = 1496 Score = 33.5 bits (73), Expect = 2.4 Identities = 24/74 (32%), Positives = 37/74 (50%), Gaps = 1/74 (1%) Frame = +1 Query: 88 QFTYTIEKIHTDQDEINNIMSYFRYDVM*SI*TNHKYNYDFGADVETGIFKKAYIYSPTR 267 QF Y+ KI EI N++ YD+ + + Y+Y F + T I KK I+ P + Sbjct: 1384 QFNYSCPKIIIQVYEIENLL--VAYDLSKKLLNKNIYSYIFFSINNTNIKKKVKIFKPHK 1441 Query: 268 -RHIRSLRVTSNRI 306 + I S++ SN I Sbjct: 1442 IKFIISIKSNSNDI 1455 >UniRef50_Q2FPP5 Cluster: Putative uncharacterized protein precursor; n=1; Methanospirillum hungatei JF-1|Rep: Putative uncharacterized protein precursor - Methanospirillum hungatei (strain JF-1 / DSM 864) Length = 337 Score = 32.7 bits (71), Expect = 4.3 Identities = 15/47 (31%), Positives = 26/47 (55%) Frame = -1 Query: 213 SEVIIIFVISSDRLHDVIAKITHNIIYFILICMNLFYRVSELWTYEI 73 S I++F+++S D + +TH I+F+LI + L + LW I Sbjct: 16 SMAILVFILASTFNEDTLQYLTHINIWFLLIAIGLRFVSFSLWAARI 62 >UniRef50_UPI0000E480D1 Cluster: PREDICTED: hypothetical protein, partial; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: hypothetical protein, partial - Strongylocentrotus purpuratus Length = 1405 Score = 32.3 bits (70), Expect = 5.6 Identities = 17/46 (36%), Positives = 26/46 (56%) Frame = +2 Query: 245 LTSIHLRGDISARCGLRQIEYSCLNYGVYDLFELEDDVGCPGTEYC 382 L HL G+ + L+ I+ +N+GVYDL LE ++G G +C Sbjct: 961 LAGKHLAGETMPK-SLKVIDLRLVNHGVYDLTSLEQELGL-GCTHC 1004 >UniRef50_A5E4U2 Cluster: Putative uncharacterized protein; n=1; Lodderomyces elongisporus NRRL YB-4239|Rep: Putative uncharacterized protein - Lodderomyces elongisporus (Yeast) (Saccharomyces elongisporus) Length = 650 Score = 32.3 bits (70), Expect = 5.6 Identities = 16/41 (39%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = -1 Query: 174 LHDVIA-KITHNIIYFILICMNLFYRVSELWTYEIFIFNLP 55 LH +A ++ H++ I + LF+ VS + Y +FIFNLP Sbjct: 90 LHKTLATQVYHSLFSKTFIHITLFHVVSAILFYGVFIFNLP 130 >UniRef50_A0DMX7 Cluster: Chromosome undetermined scaffold_57, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_57, whole genome shotgun sequence - Paramecium tetraurelia Length = 105 Score = 31.5 bits (68), Expect = 9.8 Identities = 16/48 (33%), Positives = 23/48 (47%) Frame = -1 Query: 204 IIIFVISSDRLHDVIAKITHNIIYFILICMNLFYRVSELWTYEIFIFN 61 II F SS H +I H L C L +++ WT ++FIF+ Sbjct: 20 IINFTFSSYLQHSIIFVQRHIKKEIYLNCFTLIFKLQHPWTLQLFIFH 67 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 385,418,763 Number of Sequences: 1657284 Number of extensions: 6863115 Number of successful extensions: 21968 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 21341 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21956 length of database: 575,637,011 effective HSP length: 94 effective length of database: 419,852,315 effective search space used: 26450695845 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -