BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0515 (474 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 22 3.3 AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. 21 5.8 X97819-1|CAA66399.1| 251|Tribolium castaneum ZEN Tc protein. 21 7.7 AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 21 7.7 AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. 21 7.7 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 21.8 bits (44), Expect = 3.3 Identities = 14/39 (35%), Positives = 20/39 (51%) Frame = +2 Query: 167 SCNLSELITNIIMTSEPMWKQESSKKLTSIHLRGDISAR 283 SC E+ + +I T + + +TSIHLRG I R Sbjct: 111 SCISEEVWSKLIETGN----KPPTLPVTSIHLRGAIGQR 145 >AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. Length = 256 Score = 21.0 bits (42), Expect = 5.8 Identities = 7/19 (36%), Positives = 9/19 (47%) Frame = -2 Query: 401 ISPTSDRSTPCPDSLHHPL 345 + P P D LHHP+ Sbjct: 28 VQPLPRHFNPPSDKLHHPI 46 >X97819-1|CAA66399.1| 251|Tribolium castaneum ZEN Tc protein. Length = 251 Score = 20.6 bits (41), Expect = 7.7 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = -3 Query: 388 PTAVLRARTAY 356 PTA RARTAY Sbjct: 85 PTAGKRARTAY 95 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 20.6 bits (41), Expect = 7.7 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = +1 Query: 244 AYIYSPTRRHIRSLRV 291 +YI+ P RH+ S V Sbjct: 371 SYIHDPDHRHLESFGV 386 >AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. Length = 246 Score = 20.6 bits (41), Expect = 7.7 Identities = 9/11 (81%), Positives = 9/11 (81%) Frame = -3 Query: 388 PTAVLRARTAY 356 PTA RARTAY Sbjct: 76 PTAGKRARTAY 86 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 91,698 Number of Sequences: 336 Number of extensions: 1799 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 11036865 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -