BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0515 (474 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_0891 - 32752825-32752932,32753085-32753176,32753293-327534... 29 1.4 04_01_0576 + 7466032-7466802,7468382-7468444,7469043-7469122,746... 29 2.5 07_03_1184 - 24628848-24629294 27 7.7 >01_06_0891 - 32752825-32752932,32753085-32753176,32753293-32753408, 32754055-32755969,32756037-32756171,32756549-32756870 Length = 895 Score = 29.5 bits (63), Expect = 1.4 Identities = 21/72 (29%), Positives = 34/72 (47%), Gaps = 4/72 (5%) Frame = +2 Query: 179 SELITNIIMTSEPMWKQESSKKLTSIHLRGDISARCG----LRQIEYSCLNYGVYDLFEL 346 S+ + M+S + +++ TSI G S CG + + + + N+ V D E Sbjct: 75 SDSSARVFMSSPSRIRNTDAQQSTSIRSHGQDSKYCGGMDVMNEGKETSDNFCV-DKLEK 133 Query: 347 EDDVGCPGTEYC 382 ED+VG T YC Sbjct: 134 EDEVGSCPTRYC 145 >04_01_0576 + 7466032-7466802,7468382-7468444,7469043-7469122, 7469505-7469622,7470035-7470067,7470400-7470474, 7470887-7471043,7471142-7471230,7472041-7472294, 7472977-7473148,7473250-7473333,7473626-7473730, 7474055-7474363,7474622-7474756,7476236-7476317, 7476423-7476502,7476622-7476783,7477071-7477138, 7478422-7478502,7478634-7478760,7478816-7478879, 7480808-7480854,7481042-7481335 Length = 1149 Score = 28.7 bits (61), Expect = 2.5 Identities = 9/26 (34%), Positives = 20/26 (76%) Frame = +1 Query: 64 KNKDFISPQFTYTIEKIHTDQDEINN 141 + K+ +S ++ +TI+KIH DQ+ +++ Sbjct: 1109 ETKELLSGRWNFTIQKIHRDQNRVSH 1134 >07_03_1184 - 24628848-24629294 Length = 148 Score = 27.1 bits (57), Expect = 7.7 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = +3 Query: 366 RARSTAVGSWRN*PPSQPTPVEPGERAAGLEAG 464 + R T G PPS+P PV AA L +G Sbjct: 35 KKRGTTAGGGTEHPPSRPAPVRAKSIAAELASG 67 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,165,089 Number of Sequences: 37544 Number of extensions: 182263 Number of successful extensions: 690 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 678 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 688 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 967140324 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -