Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0515
         (474 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g76540.1 68414.m08907 cell division control protein, putative...    27   6.5  

>At1g76540.1 68414.m08907 cell division control protein, putative
           similar to SWISS-PROT:Q38775, cell division control
           protein 2 homolog D [Antirrhinum majus]; contains
           protein kinase domain, Pfam:PF00069
          Length = 313

 Score = 27.1 bits (57), Expect = 6.5
 Identities = 14/49 (28%), Positives = 25/49 (51%)
 Frame = +1

Query: 247 YIYSPTRRHIRSLRVTSNRI*LFKLRSL*FIRVRG*CRLSGHGVLRSEV 393
           Y+ +  ++ IRS R T   I    ++SL +   +G     GHG+L  ++
Sbjct: 98  YMDTDVKKFIRSFRSTGKNIPTQTIKSLMYQLCKGMAFCHGHGILHRDL 146


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 8,208,936
Number of Sequences: 28952
Number of extensions: 146585
Number of successful extensions: 406
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 402
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 406
length of database: 12,070,560
effective HSP length: 75
effective length of database: 9,899,160
effective search space used: 811731120
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)