BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0514 (555 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0265 + 2148255-2150219,2150735-2150812 31 0.47 01_05_0769 - 25042022-25042447,25042856-25043234,25043714-250437... 27 7.6 >08_01_0265 + 2148255-2150219,2150735-2150812 Length = 680 Score = 31.5 bits (68), Expect = 0.47 Identities = 20/54 (37%), Positives = 31/54 (57%), Gaps = 5/54 (9%) Frame = -1 Query: 411 STALIDIAAKYGLAYDLKTVSEKM-IRNRIN----RTGDGTHPWAKQKAELEED 265 +TAL+D+ K+GL D + V E+M IRN I+ G G H ++ E+ E+ Sbjct: 356 NTALVDLYCKWGLMEDARNVFERMPIRNLISWNALIAGYGYHGMGQKAIEMFEE 409 >01_05_0769 - 25042022-25042447,25042856-25043234,25043714-25043763, 25044222-25044442,25045085-25045385 Length = 458 Score = 27.5 bits (58), Expect = 7.6 Identities = 14/50 (28%), Positives = 22/50 (44%) Frame = -1 Query: 297 WAKQKAELEEDHHHQKTLYGAGAIKTCQTMIRNWRKLFTKRMTRYKQLKR 148 WAK + L HH+K +K I + L TK R ++++R Sbjct: 157 WAKHRRILNPAFHHEKIKLPKTVVKNAPLRIVKLKFLPTKNNRRLREIER 206 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,130,963 Number of Sequences: 37544 Number of extensions: 270839 Number of successful extensions: 721 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 710 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 721 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1257681096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -