BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0512 (630 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z70267-4|CAA94210.1| 314|Caenorhabditis elegans Hypothetical pr... 32 0.29 AL021497-8|CAA16409.1| 334|Caenorhabditis elegans Hypothetical ... 28 6.3 >Z70267-4|CAA94210.1| 314|Caenorhabditis elegans Hypothetical protein K04C1.3 protein. Length = 314 Score = 32.3 bits (70), Expect = 0.29 Identities = 13/42 (30%), Positives = 27/42 (64%) Frame = +1 Query: 460 NQTQIKAHFMMIFVKFKSQFYLQRLV*HKNDCAILKKDVSIR 585 N T++ H++ F+K + Y+Q V HK++ A LK+ ++++ Sbjct: 79 NNTELLRHYLQHFIKIEEARYMQLGVIHKDNYASLKEAMNVQ 120 >AL021497-8|CAA16409.1| 334|Caenorhabditis elegans Hypothetical protein Y51A2D.12 protein. Length = 334 Score = 27.9 bits (59), Expect = 6.3 Identities = 14/36 (38%), Positives = 24/36 (66%), Gaps = 3/36 (8%) Frame = -3 Query: 115 NLNLNSS-NYTRNNLFHDFNLE*IHSR--FSTYTCA 17 NLNLN++ N+ N+FH F+ E +++ F+ + CA Sbjct: 81 NLNLNNTENWFPLNIFHTFHFEFAYTQYIFNCFVCA 116 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,448,609 Number of Sequences: 27780 Number of extensions: 191446 Number of successful extensions: 332 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 331 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 332 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1385109898 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -