BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0510 (643 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014296-2143|AAF49917.2| 492|Drosophila melanogaster CG10616-P... 36 0.062 >AE014296-2143|AAF49917.2| 492|Drosophila melanogaster CG10616-PA protein. Length = 492 Score = 35.5 bits (78), Expect = 0.062 Identities = 18/52 (34%), Positives = 29/52 (55%) Frame = +3 Query: 135 RTVYSPEHCLQYLEQYASKEIFAIGLILGQMTDARENVIHWLAHQKKKDQRL 290 RTV +H YLE+ A + F+ G+I+G D ++V+ LA ++D L Sbjct: 2 RTVLLSKHDELYLEKCAQENQFSYGIIVGHQADLTKSVVVHLARNNEEDADL 53 Score = 28.7 bits (61), Expect = 7.1 Identities = 18/65 (27%), Positives = 30/65 (46%), Gaps = 2/65 (3%) Frame = +2 Query: 314 DKPEIAKNLSSVSEAWIADHARHVTRMLPGGMFVQGIFVTS-DEDVFEDPNC-FSKLRST 487 D E+ +S ++ +A ++M PG V GIFV+S DV + + F + Sbjct: 55 DLSEVRLTISDINSQALASQWLSASKMCPGSFDVIGIFVSSVRSDVVNEQSAEFKNAKKL 114 Query: 488 LNHIY 502 + IY Sbjct: 115 FSDIY 119 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,439,046 Number of Sequences: 53049 Number of extensions: 549408 Number of successful extensions: 1036 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1023 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1036 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2703623850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -