BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0501 (394 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC101357-1|AAI01358.1| 582|Homo sapiens BTBD9 protein protein. 29 7.2 BC101355-1|AAI01356.1| 544|Homo sapiens BTB (POZ) domain contai... 29 7.2 BC101354-1|AAI01355.1| 544|Homo sapiens BTB (POZ) domain contai... 29 7.2 AL079341-1|CAI20152.1| 316|Homo sapiens protein ( Human DNA seq... 29 7.2 AK057507-1|BAB71514.1| 544|Homo sapiens protein ( Homo sapiens ... 29 7.2 AB067467-1|BAB67773.1| 642|Homo sapiens KIAA1880 protein protein. 29 7.2 >BC101357-1|AAI01358.1| 582|Homo sapiens BTBD9 protein protein. Length = 582 Score = 28.7 bits (61), Expect = 7.2 Identities = 17/35 (48%), Positives = 21/35 (60%), Gaps = 5/35 (14%) Frame = -1 Query: 127 SLNKAA---IALRFRFA--ENSIFLSLFRWCNNNN 38 SL+K A I LR FA E IFL+L WC +N+ Sbjct: 121 SLSKTALLNIVLRDSFAAPEKDIFLALLNWCKHNS 155 >BC101355-1|AAI01356.1| 544|Homo sapiens BTB (POZ) domain containing 9 protein. Length = 544 Score = 28.7 bits (61), Expect = 7.2 Identities = 17/35 (48%), Positives = 21/35 (60%), Gaps = 5/35 (14%) Frame = -1 Query: 127 SLNKAA---IALRFRFA--ENSIFLSLFRWCNNNN 38 SL+K A I LR FA E IFL+L WC +N+ Sbjct: 112 SLSKTALLNIVLRDSFAAPEKDIFLALLNWCKHNS 146 >BC101354-1|AAI01355.1| 544|Homo sapiens BTB (POZ) domain containing 9 protein. Length = 544 Score = 28.7 bits (61), Expect = 7.2 Identities = 17/35 (48%), Positives = 21/35 (60%), Gaps = 5/35 (14%) Frame = -1 Query: 127 SLNKAA---IALRFRFA--ENSIFLSLFRWCNNNN 38 SL+K A I LR FA E IFL+L WC +N+ Sbjct: 112 SLSKTALLNIVLRDSFAAPEKDIFLALLNWCKHNS 146 >AL079341-1|CAI20152.1| 316|Homo sapiens protein ( Human DNA sequence from clone RP1-319M7 on chromosome 6p21.1-21.3 Contains the 5' end of the gene for a novel protein (contains ). Length = 316 Score = 28.7 bits (61), Expect = 7.2 Identities = 17/35 (48%), Positives = 21/35 (60%), Gaps = 5/35 (14%) Frame = -1 Query: 127 SLNKAA---IALRFRFA--ENSIFLSLFRWCNNNN 38 SL+K A I LR FA E IFL+L WC +N+ Sbjct: 112 SLSKTALLNIVLRDSFAAPEKDIFLALLNWCKHNS 146 >AK057507-1|BAB71514.1| 544|Homo sapiens protein ( Homo sapiens cDNA FLJ32945 fis, clone TESTI2007867, weakly similar to RING CANAL PROTEIN. ). Length = 544 Score = 28.7 bits (61), Expect = 7.2 Identities = 17/35 (48%), Positives = 21/35 (60%), Gaps = 5/35 (14%) Frame = -1 Query: 127 SLNKAA---IALRFRFA--ENSIFLSLFRWCNNNN 38 SL+K A I LR FA E IFL+L WC +N+ Sbjct: 112 SLSKTALLNIVLRDSFAAPEKDIFLALLNWCKHNS 146 >AB067467-1|BAB67773.1| 642|Homo sapiens KIAA1880 protein protein. Length = 642 Score = 28.7 bits (61), Expect = 7.2 Identities = 17/35 (48%), Positives = 21/35 (60%), Gaps = 5/35 (14%) Frame = -1 Query: 127 SLNKAA---IALRFRFA--ENSIFLSLFRWCNNNN 38 SL+K A I LR FA E IFL+L WC +N+ Sbjct: 210 SLSKTALLNIVLRDSFAAPEKDIFLALLNWCKHNS 244 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 44,524,185 Number of Sequences: 237096 Number of extensions: 705205 Number of successful extensions: 1210 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1187 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1210 length of database: 76,859,062 effective HSP length: 82 effective length of database: 57,417,190 effective search space used: 2756025120 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -