BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0495 (618 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC29A4.16 |hal4|sat4, ppk10|halotolerence protein 4|Schizosacc... 30 0.23 SPBC1306.02 ||SPBC4.08|WD repeat protein, human WDR6 family|Schi... 30 0.23 SPAC1486.04c |alm1||medial ring protein Alm1|Schizosaccharomyces... 28 1.2 SPCC24B10.15 |||PINc domain|Schizosaccharomyces pombe|chr 3|||Ma... 26 3.8 SPCC1672.11c |||P-type ATPase |Schizosaccharomyces pombe|chr 3||... 26 5.0 SPAC57A7.05 |||conserved protein |Schizosaccharomyces pombe|chr ... 25 6.6 SPBC6B1.08c |ofd1||2-oxoglutarate and Fe|Schizosaccharomyces pom... 25 8.8 >SPAC29A4.16 |hal4|sat4, ppk10|halotolerence protein 4|Schizosaccharomyces pombe|chr 1|||Manual Length = 636 Score = 30.3 bits (65), Expect = 0.23 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = -1 Query: 618 AHCCKLPTANTPPQAKKANAPASSTVRASHLPLSSQSAKASAHV 487 AH +LP+ + PP A + A +++T + S A A+ HV Sbjct: 134 AHHAELPSGSVPPSASVSRANSTATTTPHKAGVVSNPAAANVHV 177 >SPBC1306.02 ||SPBC4.08|WD repeat protein, human WDR6 family|Schizosaccharomyces pombe|chr 2|||Manual Length = 984 Score = 30.3 bits (65), Expect = 0.23 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = -2 Query: 473 QSRHKMKLFSRFSVSFLTQLHGMSPCPLGL 384 +SRH+ L + F ++HGM PC GL Sbjct: 46 ESRHESDLIKSILLPFHNRIHGMLPCKQGL 75 >SPAC1486.04c |alm1||medial ring protein Alm1|Schizosaccharomyces pombe|chr 1|||Manual Length = 1727 Score = 27.9 bits (59), Expect = 1.2 Identities = 15/47 (31%), Positives = 28/47 (59%), Gaps = 1/47 (2%) Frame = +2 Query: 86 SEIENGKVTAVENSDKKNE-KAPILLNLEIFRITRDSQQQHGLRHAD 223 +E+ + + ++ +K+N+ K +LL E R TR+ ++ LRHAD Sbjct: 1025 NELSSHRNAEKQHLEKENDYKQQLLLVTEDLRKTREDYEKELLRHAD 1071 >SPCC24B10.15 |||PINc domain|Schizosaccharomyces pombe|chr 3|||Manual Length = 462 Score = 26.2 bits (55), Expect = 3.8 Identities = 13/40 (32%), Positives = 24/40 (60%) Frame = -2 Query: 533 RTCRFPHKVQKHLPMCTCFLQSRHKMKLFSRFSVSFLTQL 414 R C+ ++ K + T FL SRH +KL+ + ++ +T+L Sbjct: 309 RACKLLDQITKIMVEETAFLLSRHLLKLWGDYDLA-MTKL 347 >SPCC1672.11c |||P-type ATPase |Schizosaccharomyces pombe|chr 3|||Manual Length = 1315 Score = 25.8 bits (54), Expect = 5.0 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = +2 Query: 449 KVSSCVSTEESMCTWADAFALCEESGRCE 535 +V +C S + CTWA A + E C+ Sbjct: 813 RVIACASKQLENCTWAKAQRMKREQVECD 841 >SPAC57A7.05 |||conserved protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 1337 Score = 25.4 bits (53), Expect = 6.6 Identities = 15/45 (33%), Positives = 23/45 (51%), Gaps = 1/45 (2%) Frame = -1 Query: 603 LPTANTPPQAKKANAPASSTVRA-SHLPLSSQSAKASAHVHMLSS 472 +PT+ P +ANA S+T S +S +A S HV + S+ Sbjct: 1 MPTSGAPSNLDRANAQLSNTSSTESSSSNNSSTASGSRHVKIESN 45 >SPBC6B1.08c |ofd1||2-oxoglutarate and Fe|Schizosaccharomyces pombe|chr 2|||Manual Length = 515 Score = 25.0 bits (52), Expect = 8.8 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +2 Query: 332 PTLRPTMPRIDCCHT 376 PTL+P+ P D CH+ Sbjct: 176 PTLQPSFPAADFCHS 190 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,502,320 Number of Sequences: 5004 Number of extensions: 51169 Number of successful extensions: 185 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 177 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 185 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 271646730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -