BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0495 (618 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY263366-1|AAO92605.1| 139|Apis mellifera octopamine receptor p... 27 0.19 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 27 0.19 AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. 22 4.2 >AY263366-1|AAO92605.1| 139|Apis mellifera octopamine receptor protein. Length = 139 Score = 26.6 bits (56), Expect = 0.19 Identities = 14/31 (45%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = -3 Query: 547 HRTRFAPAAFLTKCKS-ICPCAHAFFSRDTR 458 H T F+ +L C S I PC +A FS+D R Sbjct: 40 HPTVFSVLFWLGYCNSAINPCIYALFSKDFR 70 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 26.6 bits (56), Expect = 0.19 Identities = 14/31 (45%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = -3 Query: 547 HRTRFAPAAFLTKCKS-ICPCAHAFFSRDTR 458 H T F+ +L C S I PC +A FS+D R Sbjct: 488 HPTVFSVLFWLGYCNSAINPCIYALFSKDFR 518 >AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. Length = 615 Score = 22.2 bits (45), Expect = 4.2 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = +2 Query: 71 MVGQESEIENGKVTAVENSDKKNEKAPILLNLEIF 175 + G+ SE+ N KV +E + A I NL+++ Sbjct: 83 VAGRLSEVSNWKVLLLEAGPDEPAGAEIPSNLQLY 117 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 171,211 Number of Sequences: 438 Number of extensions: 3886 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18337950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -