BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0493 (573 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_0191 + 23468410-23468455,23468560-23468699,23469119-234692... 27 8.0 02_04_0402 + 22618998-22619043,22619206-22619345,22620067-226201... 27 8.0 >04_04_0191 + 23468410-23468455,23468560-23468699,23469119-23469201, 23469346-23469550,23469632-23469735,23470290-23470449 Length = 245 Score = 27.5 bits (58), Expect = 8.0 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +2 Query: 431 FSYLISFVCCRSIHIYTSCTLLSFCPKRFQ 520 ++YL ++ + SC LL F KRFQ Sbjct: 3 YAYLFKYIIIGDTGVGKSCLLLQFTDKRFQ 32 >02_04_0402 + 22618998-22619043,22619206-22619345,22620067-22620149, 22620234-22620438,22620524-22620592,22621099-22621188 Length = 210 Score = 27.5 bits (58), Expect = 8.0 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +2 Query: 431 FSYLISFVCCRSIHIYTSCTLLSFCPKRFQ 520 ++YL ++ + SC LL F KRFQ Sbjct: 3 YAYLFKYIIIGDTGVGKSCLLLQFTDKRFQ 32 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,668,477 Number of Sequences: 37544 Number of extensions: 222852 Number of successful extensions: 421 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 415 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 421 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1328870592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -