BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0493 (573 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value S76957-1|AAB33932.1| 169|Apis mellifera olfactory receptor prot... 23 1.6 >S76957-1|AAB33932.1| 169|Apis mellifera olfactory receptor protein. Length = 169 Score = 23.4 bits (48), Expect = 1.6 Identities = 12/46 (26%), Positives = 25/46 (54%) Frame = -2 Query: 347 VV*VLFCGVLPSTWFVTAKTLCDHVSLKVYISVIGLFTHNPPIISS 210 V+ FC + PS + A T + +++ + +G+F+ +P I+ S Sbjct: 53 VINPFFCDMSPSLSLLCADTRLNKLAVFIVAGAVGVFS-SPTILIS 97 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 149,128 Number of Sequences: 438 Number of extensions: 3070 Number of successful extensions: 3 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16504155 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -