BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0492 (415 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_0737 - 31328473-31330513,31331015-31331184 77 4e-15 04_04_1339 + 32760424-32760584,32762428-32764462 77 7e-15 08_01_0471 - 4147170-4149207,4150535-4150692 75 2e-14 01_04_0018 + 15128174-15128316,15128445-15128544,15129573-151297... 75 2e-14 05_01_0355 - 2774217-2774318,2774608-2774775,2774872-2775090,277... 72 2e-13 01_04_0017 - 15113479-15113580,15113950-15114117,15115011-151152... 72 2e-13 03_06_0221 + 32458867-32459149,32460271-32460386,32460461-324608... 66 1e-11 03_01_0396 + 3079840-3079946,3080503-3080737,3080826-3080933,308... 29 1.1 10_08_0826 - 20840445-20840504,20840692-20840778,20841344-20841706 27 4.5 02_05_0259 - 27226378-27226398,27226643-27226813,27227063-272272... 27 4.5 11_04_0340 - 16536571-16536705,16536820-16536951,16537265-165381... 27 7.8 >02_05_0737 - 31328473-31330513,31331015-31331184 Length = 736 Score = 77.4 bits (182), Expect = 4e-15 Identities = 38/71 (53%), Positives = 50/71 (70%) Frame = -2 Query: 255 DRKMLIQSAIVRIM*TRKTLKHQHLVVEVLNQLSSRFKPRVPVIKKCIDMLIEKEYLERT 76 DRK I++AIVRIM +R+ L H +V EV QL +RF P VIKK I+ LIE+E+LER Sbjct: 666 DRKPQIEAAIVRIMKSRRVLDHNSIVAEVTKQLQARFMPNPVVIKKRIESLIEREFLERD 725 Query: 75 EGEKDTYRYLA 43 + ++ YRYLA Sbjct: 726 KADRKLYRYLA 736 >04_04_1339 + 32760424-32760584,32762428-32764462 Length = 731 Score = 76.6 bits (180), Expect = 7e-15 Identities = 38/71 (53%), Positives = 50/71 (70%) Frame = -2 Query: 255 DRKMLIQSAIVRIM*TRKTLKHQHLVVEVLNQLSSRFKPRVPVIKKCIDMLIEKEYLERT 76 DRK I++AIVRIM +R+ L H ++ EV QL SRF P VIKK I+ LIE+E+LER Sbjct: 661 DRKPQIEAAIVRIMKSRRVLDHNSIITEVTKQLQSRFLPNPVVIKKRIESLIEREFLERD 720 Query: 75 EGEKDTYRYLA 43 + ++ YRYLA Sbjct: 721 KVDRKMYRYLA 731 >08_01_0471 - 4147170-4149207,4150535-4150692 Length = 731 Score = 75.4 bits (177), Expect = 2e-14 Identities = 37/71 (52%), Positives = 49/71 (69%) Frame = -2 Query: 255 DRKMLIQSAIVRIM*TRKTLKHQHLVVEVLNQLSSRFKPRVPVIKKCIDMLIEKEYLERT 76 DRK I++AIVRIM +R+ L H +V EV QL RF P VIKK ++ LIE+E+LER Sbjct: 661 DRKPQIEAAIVRIMKSRRVLDHNSIVTEVTKQLQPRFMPNPVVIKKRVESLIEREFLERD 720 Query: 75 EGEKDTYRYLA 43 + ++ YRYLA Sbjct: 721 KTDRKLYRYLA 731 >01_04_0018 + 15128174-15128316,15128445-15128544,15129573-15129758, 15129877-15129924,15130006-15130209,15130476-15130565, 15130667-15130747,15130827-15130889,15131794-15131832, 15131914-15132000,15132103-15132252,15132331-15132386, 15132493-15132775,15132989-15133132,15133233-15133451, 15133528-15133695,15133868-15133969 Length = 720 Score = 75.4 bits (177), Expect = 2e-14 Identities = 36/71 (50%), Positives = 48/71 (67%) Frame = -2 Query: 255 DRKMLIQSAIVRIM*TRKTLKHQHLVVEVLNQLSSRFKPRVPVIKKCIDMLIEKEYLERT 76 DR+ I +++VRIM +RK L HQ LV E + QLS FKP + +IK+ I+ LI +EYLER Sbjct: 650 DRRFAIDASLVRIMKSRKVLGHQQLVAECVEQLSRMFKPDIKIIKRRIEDLISREYLERD 709 Query: 75 EGEKDTYRYLA 43 TY+YLA Sbjct: 710 SENAQTYKYLA 720 >05_01_0355 - 2774217-2774318,2774608-2774775,2774872-2775090, 2775176-2775319,2775485-2775767,2775874-2775929, 2776012-2776161,2776254-2776340,2776414-2776449, 2777100-2777162,2777247-2777327,2777407-2777496, 2777690-2777767,2777855-2778058,2778139-2778186, 2778262-2778447,2779879-2779978,2780121-2780260 Length = 744 Score = 72.1 bits (169), Expect = 2e-13 Identities = 36/71 (50%), Positives = 47/71 (66%) Frame = -2 Query: 255 DRKMLIQSAIVRIM*TRKTLKHQHLVVEVLNQLSSRFKPRVPVIKKCIDMLIEKEYLERT 76 DR+ I ++IVRIM +RK + HQ LV E + QLS FKP IKK I+ LI ++YLER Sbjct: 674 DRRYAIDASIVRIMKSRKVMGHQQLVAECVEQLSRMFKPDFKAIKKRIEDLITRDYLERE 733 Query: 75 EGEKDTYRYLA 43 + + YRYLA Sbjct: 734 KDNANVYRYLA 744 >01_04_0017 - 15113479-15113580,15113950-15114117,15115011-15115229, 15115303-15115446,15115558-15115840,15115936-15115991, 15116067-15116216,15116299-15116385,15116463-15116498, 15116746-15116808,15116887-15116967,15117053-15117142, 15117349-15117426,15117510-15117731,15117788-15117835, 15117948-15118133,15120910-15121009,15121107-15121246 Length = 750 Score = 71.7 bits (168), Expect = 2e-13 Identities = 36/71 (50%), Positives = 47/71 (66%) Frame = -2 Query: 255 DRKMLIQSAIVRIM*TRKTLKHQHLVVEVLNQLSSRFKPRVPVIKKCIDMLIEKEYLERT 76 DR+ I ++IVRIM +RK L HQ LV+E + QL FKP IKK I+ LI ++YLER Sbjct: 680 DRRYAIDASIVRIMKSRKVLGHQQLVMECVEQLGRMFKPDFKAIKKRIEDLITRDYLERD 739 Query: 75 EGEKDTYRYLA 43 + + YRYLA Sbjct: 740 KDNPNVYRYLA 750 >03_06_0221 + 32458867-32459149,32460271-32460386,32460461-32460807, 32461231-32461411,32461507-32461629,32461828-32462115, 32462536-32462688,32463068-32463169,32463260-32463313, 32463518-32463624,32463867-32463927,32464019-32464150, 32464245-32464382,32464459-32464539,32464635-32464715, 32465133-32465213,32465300-32465413 Length = 813 Score = 65.7 bits (153), Expect = 1e-11 Identities = 41/102 (40%), Positives = 56/102 (54%) Frame = -2 Query: 348 YKSKKLRVKYKHTVQDGA*S*PRGYTQTH*GDRKMLIQSAIVRIM*TRKTLKHQHLVVEV 169 Y+ K ++ K TV++ + R + DR+ + +AIVRIM TRKTL H L+ E+ Sbjct: 719 YRIKVNAIQMKETVEENTSTTERVFQ-----DRQYQVDAAIVRIMKTRKTLSHTLLITEL 773 Query: 168 LNQLSSRFKPRVPVIKKCIDMLIEKEYLERTEGEKDTYRYLA 43 QL KP IKK I+ LI++EYLER Y YLA Sbjct: 774 FQQLKFPIKP--SDIKKRIESLIDREYLERDRSNPQIYNYLA 813 >03_01_0396 + 3079840-3079946,3080503-3080737,3080826-3080933, 3081009-3081178,3081607-3081740,3081856-3082027, 3082160-3082712,3082836-3082948,3083051-3083294, 3083434-3083652 Length = 684 Score = 29.5 bits (63), Expect = 1.1 Identities = 19/50 (38%), Positives = 22/50 (44%) Frame = +1 Query: 208 RLHYPDYGGLNKHLSVSSMCLCVASWSTLSSVLNGVFIFHAELFALVSRV 357 RLHYP Y K + SS L S T + + FI H E A RV Sbjct: 192 RLHYPAYDKFLKEMDKSSEFLQKVSTPTGTELAEDEFILHIEGTAGTQRV 241 >10_08_0826 - 20840445-20840504,20840692-20840778,20841344-20841706 Length = 169 Score = 27.5 bits (58), Expect = 4.5 Identities = 17/49 (34%), Positives = 22/49 (44%) Frame = -1 Query: 163 PVVVTVQAQSSCHQEMHRYAD*EGIFRAYRGREGHLQIPGVIAPLAGRK 17 P+ + Q HQE + Y G R G E +L+ PG P A RK Sbjct: 20 PLRLLQQQHGEDHQEEYGYGSSGGCCRTPTGGESNLKAPGTCPP-APRK 67 >02_05_0259 - 27226378-27226398,27226643-27226813,27227063-27227284, 27227508-27227668,27227933-27227996,27228002-27228194, 27228499-27228587,27228668-27228852,27229671-27229779, 27229880-27229936,27230023-27230175 Length = 474 Score = 27.5 bits (58), Expect = 4.5 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = +2 Query: 131 GTLGLNRDDNWLRTST 178 G G +RDDNW+ TST Sbjct: 365 GKFGQSRDDNWVSTST 380 >11_04_0340 - 16536571-16536705,16536820-16536951,16537265-16538106, 16538480-16538940,16539032-16540314,16540423-16541627, 16541857-16542157 Length = 1452 Score = 26.6 bits (56), Expect = 7.8 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +1 Query: 202 LARLHYPDYGGLNKHLSVSSMCLCVASWST 291 L RLH D +NK L + +C +AS+ST Sbjct: 1360 LTRLHSADCIQINKILHIVVVCAALASFST 1389 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,407,150 Number of Sequences: 37544 Number of extensions: 194310 Number of successful extensions: 499 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 486 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 498 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 742607976 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -