BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0491 (431 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U26712-1|AAB09293.1| 770|Homo sapiens cbl-b truncated form 2 pr... 31 1.7 U26711-1|AAB09292.1| 810|Homo sapiens cbl-b truncated form 1 pr... 31 1.7 U26710-1|AAB09291.1| 982|Homo sapiens cbl-b protein. 31 1.7 BC032851-1|AAH32851.1| 982|Homo sapiens Cas-Br-M (murine) ecotr... 31 1.7 BC033786-1|AAH33786.2| 465|Homo sapiens ring finger protein 38 ... 30 2.9 AL354935-3|CAO03541.1| 465|Homo sapiens ring finger protein 38 ... 30 2.9 AL354935-2|CAO03540.1| 515|Homo sapiens ring finger protein 38 ... 30 2.9 AL354935-1|CAH70194.1| 439|Homo sapiens ring finger protein 38 ... 30 2.9 AL161792-4|CAO03554.1| 465|Homo sapiens ring finger protein 38 ... 30 2.9 AL161792-3|CAO03553.1| 515|Homo sapiens ring finger protein 38 ... 30 2.9 AL161792-1|CAI16895.1| 439|Homo sapiens ring finger protein 38 ... 30 2.9 AK024996-1|BAB15050.1| 332|Homo sapiens protein ( Homo sapiens ... 30 2.9 AF394047-1|AAM73697.1| 432|Homo sapiens RING finger protein 38 ... 30 2.9 AL117478-1|CAB55951.1| 698|Homo sapiens hypothetical protein pr... 29 5.1 BC051816-1|AAH51816.1| 454|Homo sapiens family with sequence si... 29 6.8 BC037240-1|AAH37240.2| 454|Homo sapiens family with sequence si... 29 6.8 BC014247-1|AAH14247.1| 312|Homo sapiens FAM113A protein protein. 29 6.8 AL161656-2|CAC21464.1| 403|Homo sapiens family with sequence si... 29 6.8 AL161656-1|CAC21463.1| 454|Homo sapiens family with sequence si... 29 6.8 AK056353-1|BAB71160.1| 454|Homo sapiens protein ( Homo sapiens ... 29 6.8 AK026029-1|BAB15328.1| 403|Homo sapiens protein ( Homo sapiens ... 29 6.8 BX284686-2|CAM26210.1| 306|Homo sapiens proline-rich transmembr... 29 9.0 BC063046-1|AAH63046.1| 306|Homo sapiens proline-rich transmembr... 29 9.0 AL845464-1|CAI41794.2| 306|Homo sapiens proline-rich transmembr... 29 9.0 AL662884-7|CAI18339.2| 306|Homo sapiens proline-rich transmembr... 29 9.0 AL662828-7|CAI17422.2| 306|Homo sapiens proline-rich transmembr... 29 9.0 AK054885-1|BAB70821.1| 306|Homo sapiens protein ( Homo sapiens ... 29 9.0 AJ238850-1|CAB52754.1| 1203|Homo sapiens hyperpolarization-activ... 29 9.0 AJ132429-1|CAB42604.1| 1203|Homo sapiens hyperpolarization-activ... 29 9.0 >U26712-1|AAB09293.1| 770|Homo sapiens cbl-b truncated form 2 protein. Length = 770 Score = 31.1 bits (67), Expect = 1.7 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = -1 Query: 167 REAERPLPACSPPLADMLVLRPEQFIPLPP 78 R+ ++PLPA PPL D PE+ P+PP Sbjct: 538 RKQDKPLPAPPPPLRDPPPPPPERPPPIPP 567 >U26711-1|AAB09292.1| 810|Homo sapiens cbl-b truncated form 1 protein. Length = 810 Score = 31.1 bits (67), Expect = 1.7 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = -1 Query: 167 REAERPLPACSPPLADMLVLRPEQFIPLPP 78 R+ ++PLPA PPL D PE+ P+PP Sbjct: 538 RKQDKPLPAPPPPLRDPPPPPPERPPPIPP 567 >U26710-1|AAB09291.1| 982|Homo sapiens cbl-b protein. Length = 982 Score = 31.1 bits (67), Expect = 1.7 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = -1 Query: 167 REAERPLPACSPPLADMLVLRPEQFIPLPP 78 R+ ++PLPA PPL D PE+ P+PP Sbjct: 538 RKQDKPLPAPPPPLRDPPPPPPERPPPIPP 567 >BC032851-1|AAH32851.1| 982|Homo sapiens Cas-Br-M (murine) ecotropic retroviral transforming sequence b protein. Length = 982 Score = 31.1 bits (67), Expect = 1.7 Identities = 14/30 (46%), Positives = 19/30 (63%) Frame = -1 Query: 167 REAERPLPACSPPLADMLVLRPEQFIPLPP 78 R+ ++PLPA PPL D PE+ P+PP Sbjct: 538 RKQDKPLPAPPPPLRDPPPPPPERPPPIPP 567 >BC033786-1|AAH33786.2| 465|Homo sapiens ring finger protein 38 protein. Length = 465 Score = 30.3 bits (65), Expect = 2.9 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 98 VPVEVQAYPLMVDCRPGAGAPPHELPHPAPNGAPP 202 +PV A+P ++ P PPH PH P+ PP Sbjct: 206 LPVPYAAFPPLISSDPFLIHPPHLSPHHPPHLPPP 240 >AL354935-3|CAO03541.1| 465|Homo sapiens ring finger protein 38 protein. Length = 465 Score = 30.3 bits (65), Expect = 2.9 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 98 VPVEVQAYPLMVDCRPGAGAPPHELPHPAPNGAPP 202 +PV A+P ++ P PPH PH P+ PP Sbjct: 206 LPVPYAAFPPLISSDPFLIHPPHLSPHHPPHLPPP 240 >AL354935-2|CAO03540.1| 515|Homo sapiens ring finger protein 38 protein. Length = 515 Score = 30.3 bits (65), Expect = 2.9 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 98 VPVEVQAYPLMVDCRPGAGAPPHELPHPAPNGAPP 202 +PV A+P ++ P PPH PH P+ PP Sbjct: 256 LPVPYAAFPPLISSDPFLIHPPHLSPHHPPHLPPP 290 >AL354935-1|CAH70194.1| 439|Homo sapiens ring finger protein 38 protein. Length = 439 Score = 30.3 bits (65), Expect = 2.9 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 98 VPVEVQAYPLMVDCRPGAGAPPHELPHPAPNGAPP 202 +PV A+P ++ P PPH PH P+ PP Sbjct: 180 LPVPYAAFPPLISSDPFLIHPPHLSPHHPPHLPPP 214 >AL161792-4|CAO03554.1| 465|Homo sapiens ring finger protein 38 protein. Length = 465 Score = 30.3 bits (65), Expect = 2.9 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 98 VPVEVQAYPLMVDCRPGAGAPPHELPHPAPNGAPP 202 +PV A+P ++ P PPH PH P+ PP Sbjct: 206 LPVPYAAFPPLISSDPFLIHPPHLSPHHPPHLPPP 240 >AL161792-3|CAO03553.1| 515|Homo sapiens ring finger protein 38 protein. Length = 515 Score = 30.3 bits (65), Expect = 2.9 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 98 VPVEVQAYPLMVDCRPGAGAPPHELPHPAPNGAPP 202 +PV A+P ++ P PPH PH P+ PP Sbjct: 256 LPVPYAAFPPLISSDPFLIHPPHLSPHHPPHLPPP 290 >AL161792-1|CAI16895.1| 439|Homo sapiens ring finger protein 38 protein. Length = 439 Score = 30.3 bits (65), Expect = 2.9 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 98 VPVEVQAYPLMVDCRPGAGAPPHELPHPAPNGAPP 202 +PV A+P ++ P PPH PH P+ PP Sbjct: 180 LPVPYAAFPPLISSDPFLIHPPHLSPHHPPHLPPP 214 >AK024996-1|BAB15050.1| 332|Homo sapiens protein ( Homo sapiens cDNA: FLJ21343 fis, clone COL02679. ). Length = 332 Score = 30.3 bits (65), Expect = 2.9 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 98 VPVEVQAYPLMVDCRPGAGAPPHELPHPAPNGAPP 202 +PV A+P ++ P PPH PH P+ PP Sbjct: 73 LPVPYAAFPPLISSDPFLIHPPHLSPHHPPHLPPP 107 >AF394047-1|AAM73697.1| 432|Homo sapiens RING finger protein 38 protein. Length = 432 Score = 30.3 bits (65), Expect = 2.9 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 98 VPVEVQAYPLMVDCRPGAGAPPHELPHPAPNGAPP 202 +PV A+P ++ P PPH PH P+ PP Sbjct: 173 LPVPYAAFPPLISSDPFLIHPPHLSPHHPPHLPPP 207 >AL117478-1|CAB55951.1| 698|Homo sapiens hypothetical protein protein. Length = 698 Score = 29.5 bits (63), Expect = 5.1 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = +2 Query: 101 PVEVQAYPLMVDCRPGAGAPPHELPHPAPNGAPP 202 P + A PL + RPGAG PP PH G P Sbjct: 511 PCDRHAPPLQL--RPGAGLPPSLSPHSPARGQQP 542 >BC051816-1|AAH51816.1| 454|Homo sapiens family with sequence similarity 113, member A protein. Length = 454 Score = 29.1 bits (62), Expect = 6.8 Identities = 14/37 (37%), Positives = 16/37 (43%) Frame = +2 Query: 101 PVEVQAYPLMVDCRPGAGAPPHELPHPAPNGAPPDNH 211 PVE + P + C PG P LP P P P H Sbjct: 362 PVEDFSMPPHLGCGPGVNFVPGPLPPPIPGPNPHGQH 398 >BC037240-1|AAH37240.2| 454|Homo sapiens family with sequence similarity 113, member A protein. Length = 454 Score = 29.1 bits (62), Expect = 6.8 Identities = 14/37 (37%), Positives = 16/37 (43%) Frame = +2 Query: 101 PVEVQAYPLMVDCRPGAGAPPHELPHPAPNGAPPDNH 211 PVE + P + C PG P LP P P P H Sbjct: 362 PVEDFSMPPHLGCGPGVNFVPGPLPPPIPGPNPHGQH 398 >BC014247-1|AAH14247.1| 312|Homo sapiens FAM113A protein protein. Length = 312 Score = 29.1 bits (62), Expect = 6.8 Identities = 14/37 (37%), Positives = 16/37 (43%) Frame = +2 Query: 101 PVEVQAYPLMVDCRPGAGAPPHELPHPAPNGAPPDNH 211 PVE + P + C PG P LP P P P H Sbjct: 220 PVEDFSMPPHLGCGPGVNFVPGPLPPPIPGPNPHGQH 256 >AL161656-2|CAC21464.1| 403|Homo sapiens family with sequence similarity 113, member A protein. Length = 403 Score = 29.1 bits (62), Expect = 6.8 Identities = 14/37 (37%), Positives = 16/37 (43%) Frame = +2 Query: 101 PVEVQAYPLMVDCRPGAGAPPHELPHPAPNGAPPDNH 211 PVE + P + C PG P LP P P P H Sbjct: 311 PVEDFSMPPHLGCGPGVNFVPGPLPPPIPGPNPHGQH 347 >AL161656-1|CAC21463.1| 454|Homo sapiens family with sequence similarity 113, member A protein. Length = 454 Score = 29.1 bits (62), Expect = 6.8 Identities = 14/37 (37%), Positives = 16/37 (43%) Frame = +2 Query: 101 PVEVQAYPLMVDCRPGAGAPPHELPHPAPNGAPPDNH 211 PVE + P + C PG P LP P P P H Sbjct: 362 PVEDFSMPPHLGCGPGVNFVPGPLPPPIPGPNPHGQH 398 >AK056353-1|BAB71160.1| 454|Homo sapiens protein ( Homo sapiens cDNA FLJ31791 fis, clone NT2RI2008749, weakly similar to SPLICEOSOME ASSOCIATED PROTEIN 49. ). Length = 454 Score = 29.1 bits (62), Expect = 6.8 Identities = 14/37 (37%), Positives = 16/37 (43%) Frame = +2 Query: 101 PVEVQAYPLMVDCRPGAGAPPHELPHPAPNGAPPDNH 211 PVE + P + C PG P LP P P P H Sbjct: 362 PVEDFSMPPHLGCGPGVNFVPGPLPPPIPGPNPHGQH 398 >AK026029-1|BAB15328.1| 403|Homo sapiens protein ( Homo sapiens cDNA: FLJ22376 fis, clone HRC07327. ). Length = 403 Score = 29.1 bits (62), Expect = 6.8 Identities = 14/37 (37%), Positives = 16/37 (43%) Frame = +2 Query: 101 PVEVQAYPLMVDCRPGAGAPPHELPHPAPNGAPPDNH 211 PVE + P + C PG P LP P P P H Sbjct: 311 PVEDFSMPPHLGCGPGVNFVPGPLPPPIPGPNPHGQH 347 >BX284686-2|CAM26210.1| 306|Homo sapiens proline-rich transmembrane protein 1 protein. Length = 306 Score = 28.7 bits (61), Expect = 9.0 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 149 AGAPPHELPHPAPNGAPPDNHHN 217 A PP E P P P AP +HH+ Sbjct: 22 APQPPAEPPAPPPQAAPSSHHHH 44 >BC063046-1|AAH63046.1| 306|Homo sapiens proline-rich transmembrane protein 1 protein. Length = 306 Score = 28.7 bits (61), Expect = 9.0 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 149 AGAPPHELPHPAPNGAPPDNHHN 217 A PP E P P P AP +HH+ Sbjct: 22 APQPPAEPPAPPPQAAPSSHHHH 44 >AL845464-1|CAI41794.2| 306|Homo sapiens proline-rich transmembrane protein 1 protein. Length = 306 Score = 28.7 bits (61), Expect = 9.0 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 149 AGAPPHELPHPAPNGAPPDNHHN 217 A PP E P P P AP +HH+ Sbjct: 22 APQPPAEPPAPPPQAAPSSHHHH 44 >AL662884-7|CAI18339.2| 306|Homo sapiens proline-rich transmembrane protein 1 protein. Length = 306 Score = 28.7 bits (61), Expect = 9.0 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 149 AGAPPHELPHPAPNGAPPDNHHN 217 A PP E P P P AP +HH+ Sbjct: 22 APQPPAEPPAPPPQAAPSSHHHH 44 >AL662828-7|CAI17422.2| 306|Homo sapiens proline-rich transmembrane protein 1 protein. Length = 306 Score = 28.7 bits (61), Expect = 9.0 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 149 AGAPPHELPHPAPNGAPPDNHHN 217 A PP E P P P AP +HH+ Sbjct: 22 APQPPAEPPAPPPQAAPSSHHHH 44 >AK054885-1|BAB70821.1| 306|Homo sapiens protein ( Homo sapiens cDNA FLJ30323 fis, clone BRACE2007109, highly similar to Extensin-like protein NG5. ). Length = 306 Score = 28.7 bits (61), Expect = 9.0 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 149 AGAPPHELPHPAPNGAPPDNHHN 217 A PP E P P P AP +HH+ Sbjct: 22 APQPPAEPPAPPPQAAPSSHHHH 44 >AJ238850-1|CAB52754.1| 1203|Homo sapiens hyperpolarization-activated channel type 4 protein. Length = 1203 Score = 28.7 bits (61), Expect = 9.0 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +2 Query: 122 PLMVDCRPGAGAPPHELPHPAPNGA 196 PL+ +PGA +P P PAP GA Sbjct: 924 PLLTPLQPGARSPQAAQPSPAPPGA 948 >AJ132429-1|CAB42604.1| 1203|Homo sapiens hyperpolarization-activated cyclic nucleotide gated cation channel hHCN4 protein. Length = 1203 Score = 28.7 bits (61), Expect = 9.0 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +2 Query: 122 PLMVDCRPGAGAPPHELPHPAPNGA 196 PL+ +PGA +P P PAP GA Sbjct: 924 PLLTPLQPGARSPQAAQPSPAPPGA 948 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 52,358,942 Number of Sequences: 237096 Number of extensions: 941784 Number of successful extensions: 5173 Number of sequences better than 10.0: 29 Number of HSP's better than 10.0 without gapping: 4383 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5122 length of database: 76,859,062 effective HSP length: 83 effective length of database: 57,180,094 effective search space used: 3430805640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -