BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0487 (691 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI00006CA520 Cluster: hypothetical protein TTHERM_0067... 33 6.6 >UniRef50_UPI00006CA520 Cluster: hypothetical protein TTHERM_00678500; n=1; Tetrahymena thermophila SB210|Rep: hypothetical protein TTHERM_00678500 - Tetrahymena thermophila SB210 Length = 507 Score = 33.1 bits (72), Expect = 6.6 Identities = 35/130 (26%), Positives = 51/130 (39%), Gaps = 4/130 (3%) Frame = -1 Query: 640 IIVLPNYGKSIPKEVNVHNNSVSELY----EI*I*DLRLGIKS*PNYCE*EVTLFQSASW 473 I + NY ++ K + VH NS +L +I I L K Y Q Sbjct: 80 IQIQKNYILNLQKSIKVHQNSQLQLQKTKNKIQISQLNSLQKENKKYEVMPCLAIQGKKK 139 Query: 472 MTQVNLFTGQHE**DLSKTRSKISTVATTCYSGDNLSSTSLSCLESVLVSRFLTNSFLTN 293 Q+ + +++ DL K +S++ SGDNL S L+ S N L N Sbjct: 140 EMQLQVLKRENKKQDLEKEKSQVKEEKKNLISGDNLKVES-QLLQQAYESNPCINQ-LNN 197 Query: 292 KCFSRKSDLI 263 KC RK + Sbjct: 198 KCEKRKEGFV 207 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 581,533,067 Number of Sequences: 1657284 Number of extensions: 10183975 Number of successful extensions: 22542 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 21924 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22539 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 54132236449 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -