BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0487 (691 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292351-1|CAL23163.2| 394|Tribolium castaneum gustatory recept... 22 4.1 AM292350-1|CAL23162.2| 429|Tribolium castaneum gustatory recept... 22 4.1 AM292328-1|CAL23140.2| 429|Tribolium castaneum gustatory recept... 22 4.1 EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 21 9.5 EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 21 9.5 >AM292351-1|CAL23163.2| 394|Tribolium castaneum gustatory receptor candidate 30 protein. Length = 394 Score = 22.2 bits (45), Expect = 4.1 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = +2 Query: 416 SLAQILLFVLSSKEIHLRHPTRTLEQCYFLFAIIWL 523 S A LLF+L LR LE+ YF ++ +L Sbjct: 294 SFASDLLFILIQLFNSLRQMKNNLERIYFYWSFGFL 329 >AM292350-1|CAL23162.2| 429|Tribolium castaneum gustatory receptor candidate 29 protein. Length = 429 Score = 22.2 bits (45), Expect = 4.1 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = +2 Query: 416 SLAQILLFVLSSKEIHLRHPTRTLEQCYFLFAIIWL 523 S A LLF+L LR LE+ YF ++ +L Sbjct: 294 SFASDLLFILIQLFNSLRQMKNNLERIYFYWSFGFL 329 >AM292328-1|CAL23140.2| 429|Tribolium castaneum gustatory receptor candidate 7 protein. Length = 429 Score = 22.2 bits (45), Expect = 4.1 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = +2 Query: 416 SLAQILLFVLSSKEIHLRHPTRTLEQCYFLFAIIWL 523 S A LLF+L LR LE+ YF ++ +L Sbjct: 294 SFASDLLFILIQLFNSLRQMKNNLERIYFYWSFGFL 329 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 21.0 bits (42), Expect = 9.5 Identities = 6/13 (46%), Positives = 11/13 (84%) Frame = -2 Query: 579 VFPNYMKSRSKIY 541 VFPNY+++ S ++ Sbjct: 62 VFPNYIRTTSMVF 74 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 21.0 bits (42), Expect = 9.5 Identities = 6/13 (46%), Positives = 11/13 (84%) Frame = -2 Query: 579 VFPNYMKSRSKIY 541 VFPNY+++ S ++ Sbjct: 62 VFPNYIRTTSMVF 74 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 143,201 Number of Sequences: 336 Number of extensions: 2781 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18114270 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -