BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0487 (691 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC3D6.06c |||ribose-phosphate pyrophosphokinase |Schizosacchar... 30 0.27 SPAC2G11.11c |prh1||ATP-dependent RNA helicase Prh1|Schizosaccha... 27 2.6 SPBC359.01 ||SPBPB10D8.08|amino acid permease, unknown 7|Schizos... 27 3.4 SPAC821.04c |cid13||poly|Schizosaccharomyces pombe|chr 1|||Manual 27 3.4 SPBC25B2.07c |mug164||microtubule-associated protein|Schizosacch... 26 5.9 SPBC211.03c |||guanyl-nucleotide exchange factor|Schizosaccharom... 26 5.9 SPAC24H6.11c |||sulfate transporter |Schizosaccharomyces pombe|c... 26 5.9 >SPBC3D6.06c |||ribose-phosphate pyrophosphokinase |Schizosaccharomyces pombe|chr 2|||Manual Length = 341 Score = 30.3 bits (65), Expect = 0.27 Identities = 14/44 (31%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = -1 Query: 412 SKISTVATTCY-SGDNLSSTSLSCLESVLVSRFLTNSFLTNKCF 284 SKI + T C SGD + LSC++ ++V+ + + CF Sbjct: 265 SKIYALVTHCVLSGDAIERVKLSCIDKLIVTNTAPQTITPSGCF 308 >SPAC2G11.11c |prh1||ATP-dependent RNA helicase Prh1|Schizosaccharomyces pombe|chr 1|||Manual Length = 719 Score = 27.1 bits (57), Expect = 2.6 Identities = 9/25 (36%), Positives = 19/25 (76%) Frame = -2 Query: 234 NDTSRMTELILSFTNKIIRKQPLVK 160 ++ + MT+++L F KII+K+P ++ Sbjct: 219 HERTLMTDMLLGFVKKIIKKRPALR 243 >SPBC359.01 ||SPBPB10D8.08|amino acid permease, unknown 7|Schizosaccharomyces pombe|chr 2|||Manual Length = 581 Score = 26.6 bits (56), Expect = 3.4 Identities = 8/25 (32%), Positives = 13/25 (52%) Frame = +3 Query: 429 SYYSCCPVKRFTCVIQLALWNSVTS 503 +Y+ CP++ TC I W + S Sbjct: 165 NYFVTCPLELTTCAITFKFWTEINS 189 >SPAC821.04c |cid13||poly|Schizosaccharomyces pombe|chr 1|||Manual Length = 578 Score = 26.6 bits (56), Expect = 3.4 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = +3 Query: 354 DVELKLSPE*QVVATVEIFDRVLLRSYYSCCPVKRFTCVIQLALW 488 D EL+LS + + T+ + L+RSY C P R ++ + W Sbjct: 156 DSELQLSCDCNINKTISTLNTRLMRSYVLCDPRVR-PLIVMIKYW 199 >SPBC25B2.07c |mug164||microtubule-associated protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 501 Score = 25.8 bits (54), Expect = 5.9 Identities = 14/38 (36%), Positives = 23/38 (60%), Gaps = 1/38 (2%) Frame = -1 Query: 682 RLYQDPSKKWG-S*AIIVLPNYGKSIPKEVNVHNNSVS 572 R ++PS++ S ++ L N IPKE ++H NS+S Sbjct: 100 RNIRNPSQRLRPSTSLARLSNNAPRIPKEASLHENSIS 137 >SPBC211.03c |||guanyl-nucleotide exchange factor|Schizosaccharomyces pombe|chr 2|||Manual Length = 1462 Score = 25.8 bits (54), Expect = 5.9 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = +2 Query: 401 RDFRSSLAQILLFVLSSK 454 RDFR+ LA ++LF +SSK Sbjct: 866 RDFRAQLALLVLFWISSK 883 >SPAC24H6.11c |||sulfate transporter |Schizosaccharomyces pombe|chr 1|||Manual Length = 958 Score = 25.8 bits (54), Expect = 5.9 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -1 Query: 427 LSKTRSKISTVATTCYSGDN 368 L +TRS T+ T C+ GD+ Sbjct: 697 LDETRSSFKTLTTMCFGGDD 716 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,581,247 Number of Sequences: 5004 Number of extensions: 49386 Number of successful extensions: 135 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 133 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 135 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 319939482 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -