BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0487 (691 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g01470.1 68418.m00060 expressed protein 28 6.7 At3g47790.1 68416.m05206 ABC transporter family protein contains... 28 6.7 >At5g01470.1 68418.m00060 expressed protein Length = 241 Score = 27.9 bits (59), Expect = 6.7 Identities = 15/45 (33%), Positives = 26/45 (57%) Frame = +3 Query: 228 YRYDMTHSRVLKMRSDLREKHLFVRKEFVKNLDTRTLSKHDRDVE 362 +RY + R L++ S +F++KEF NLD T +D+++E Sbjct: 71 HRYLIERRRCLEIGSGTGALAIFLKKEF--NLDITTSDYNDQEIE 113 >At3g47790.1 68416.m05206 ABC transporter family protein contains Pfam domain, PF00005: ABC transporter Length = 901 Score = 27.9 bits (59), Expect = 6.7 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 2/34 (5%) Frame = +2 Query: 578 TIIMYVYFFRNRFSVIWQYYYSLTTPLF--GWIL 673 T+I Y+Y F I+ + + L PLF GWI+ Sbjct: 429 TVIAYIYVFGTGLLGIFLFQFFLEDPLFPRGWII 462 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,601,117 Number of Sequences: 28952 Number of extensions: 225933 Number of successful extensions: 503 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 497 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 503 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1467502800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -