BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0482 (585 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_5776| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_7689| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.5 >SB_5776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 29.5 bits (63), Expect = 2.1 Identities = 19/60 (31%), Positives = 28/60 (46%), Gaps = 4/60 (6%) Frame = +2 Query: 119 DSRKLKLYEAGGSLFAQ*CLVITIPQSRQSYRSILYVL--CLVKRKINFVFDNRYT--FC 286 D + YE G L CLV+++ S SYR + +L C ++ VF R+ FC Sbjct: 19 DDAEAGFYEKGLGLHFANCLVLSVINSAMSYRGLRLLLFYCRIRCIATRVFKTRFVLGFC 78 >SB_7689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 612 Score = 27.5 bits (58), Expect = 8.5 Identities = 16/35 (45%), Positives = 20/35 (57%) Frame = +1 Query: 109 LFRRFKEVEALRGGRLLICAIMSRYYHPAISSKLP 213 L+R F L RLL C+++S YY P SS LP Sbjct: 2 LYRIFLATFLLSRCRLLTCSLLSPYYDP--SSLLP 34 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,274,759 Number of Sequences: 59808 Number of extensions: 326681 Number of successful extensions: 552 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 531 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 552 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1410146228 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -