Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0482
         (585 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g14690.1 68414.m01756 microtubule associated protein (MAP65/A...    27   9.2  

>At1g14690.1 68414.m01756 microtubule associated protein
           (MAP65/ASE1) family protein low similarity to SP|P32380
           NUF1 protein (Spindle poly body spacer protein SPC110)
           {Saccharomyces cerevisiae}, smooth muscle myosin heavy
           chain [Homo sapiens] GI:4417214; contains Pfam profile
           PF03999: Microtubule associated protein (MAP65/ASE1
           family)
          Length = 707

 Score = 27.1 bits (57), Expect = 9.2
 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 1/50 (2%)
 Frame = +2

Query: 86  FMTQ*YFDYFADSR-KLKLYEAGGSLFAQ*CLVITIPQSRQSYRSILYVL 232
           F+T  +FD  A S   ++L +  GSLF    L+ T  + R  + S+ YV+
Sbjct: 251 FVTDYHFDALAFSPLSVQLKDVAGSLFELWNLMDTSQEERTKFASVSYVV 300


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,979,486
Number of Sequences: 28952
Number of extensions: 231041
Number of successful extensions: 435
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 430
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 435
length of database: 12,070,560
effective HSP length: 77
effective length of database: 9,841,256
effective search space used: 1151426952
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)