BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0480 (708 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles ... 50 5e-08 AY334011-1|AAR01136.1| 188|Anopheles gambiae beta-tubulin protein. 42 3e-05 AY334010-1|AAR01135.1| 188|Anopheles gambiae beta-tubulin protein. 42 3e-05 AY334009-1|AAR01134.1| 188|Anopheles gambiae beta-tubulin protein. 42 3e-05 AY334008-1|AAR01133.1| 188|Anopheles gambiae beta-tubulin protein. 42 3e-05 AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript... 27 0.056 AY390608-1|AAR27305.1| 242|Anopheles gambiae SP22D protein. 27 0.58 AY390607-1|AAR27304.1| 242|Anopheles gambiae SP22D protein. 27 0.58 AY390606-1|AAR27303.1| 241|Anopheles gambiae SP22D protein. 27 0.58 AY390605-1|AAR27302.1| 241|Anopheles gambiae SP22D protein. 27 0.58 AY390604-1|AAR27301.1| 241|Anopheles gambiae SP22D protein. 27 0.58 AY390603-1|AAR27300.1| 241|Anopheles gambiae SP22D protein. 27 0.58 AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 27 0.58 AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 27 0.58 AF515521-1|AAM61888.1| 233|Anopheles gambiae glutathione S-tran... 25 1.8 EF117201-1|ABL67438.1| 481|Anopheles gambiae serpin 17 protein. 25 3.1 AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 24 5.4 AY028784-1|AAK32958.2| 499|Anopheles gambiae cytochrome P450 pr... 23 9.4 >U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles gambiae putativetubulin alpha chain mRNA, complete cds. ). Length = 91 Score = 50.4 bits (115), Expect = 5e-08 Identities = 20/22 (90%), Positives = 21/22 (95%) Frame = +2 Query: 65 MRECISVHVGQAGVQIGNACWE 130 MRECISVHVGQAGVQIGN CW+ Sbjct: 1 MRECISVHVGQAGVQIGNPCWD 22 Score = 37.9 bits (84), Expect = 3e-04 Identities = 21/45 (46%), Positives = 23/45 (51%) Frame = +3 Query: 120 PAGSFTAWSTASSLMARCPQTRPSGVETILSTLSSARPELASTYP 254 P T WS AS+ RCP+TR S ST SS R AST P Sbjct: 19 PCWDCTVWSMASNRTVRCPRTRRSEAVMTRSTPSSPRLAQASTCP 63 >AY334011-1|AAR01136.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 41.5 bits (93), Expect = 3e-05 Identities = 18/33 (54%), Positives = 22/33 (66%) Frame = +1 Query: 382 HYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFH 480 HYT G E+VD VLD +RK + C LQGF + H Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGFQLTH 33 Score = 37.9 bits (84), Expect = 3e-04 Identities = 22/65 (33%), Positives = 36/65 (55%) Frame = +3 Query: 513 SLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNFLFSPPTQTLEHF*LVLSWSTNET 692 +LL+ ++ +Y + +++ P+P+VS VVEPYN S Q +E+ NE Sbjct: 45 TLLISKIREEYPDRIMNTYSVVPSPKVSDTVVEPYNATLS-IHQLVENTDETYC-IDNEA 102 Query: 693 IYDIC 707 +YDIC Sbjct: 103 LYDIC 107 >AY334010-1|AAR01135.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 41.5 bits (93), Expect = 3e-05 Identities = 18/33 (54%), Positives = 22/33 (66%) Frame = +1 Query: 382 HYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFH 480 HYT G E+VD VLD +RK + C LQGF + H Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGFQLTH 33 Score = 37.9 bits (84), Expect = 3e-04 Identities = 22/65 (33%), Positives = 36/65 (55%) Frame = +3 Query: 513 SLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNFLFSPPTQTLEHF*LVLSWSTNET 692 +LL+ ++ +Y + +++ P+P+VS VVEPYN S Q +E+ NE Sbjct: 45 TLLISKIREEYPDRIMNTYSVVPSPKVSDTVVEPYNATLS-IHQLVENTDETYC-IDNEA 102 Query: 693 IYDIC 707 +YDIC Sbjct: 103 LYDIC 107 >AY334009-1|AAR01134.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 41.5 bits (93), Expect = 3e-05 Identities = 18/33 (54%), Positives = 22/33 (66%) Frame = +1 Query: 382 HYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFH 480 HYT G E+VD VLD +RK + C LQGF + H Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGFQLTH 33 Score = 37.9 bits (84), Expect = 3e-04 Identities = 22/65 (33%), Positives = 36/65 (55%) Frame = +3 Query: 513 SLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNFLFSPPTQTLEHF*LVLSWSTNET 692 +LL+ ++ +Y + +++ P+P+VS VVEPYN S Q +E+ NE Sbjct: 45 TLLISKIREEYPDRIMNTYSVVPSPKVSDTVVEPYNATLS-IHQLVENTDETYC-IDNEA 102 Query: 693 IYDIC 707 +YDIC Sbjct: 103 LYDIC 107 >AY334008-1|AAR01133.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 41.5 bits (93), Expect = 3e-05 Identities = 18/33 (54%), Positives = 22/33 (66%) Frame = +1 Query: 382 HYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFH 480 HYT G E+VD VLD +RK + C LQGF + H Sbjct: 1 HYTEGAELVDAVLDVVRKECENCDCLQGFQLTH 33 Score = 37.9 bits (84), Expect = 3e-04 Identities = 22/65 (33%), Positives = 36/65 (55%) Frame = +3 Query: 513 SLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNFLFSPPTQTLEHF*LVLSWSTNET 692 +LL+ ++ +Y + +++ P+P+VS VVEPYN S Q +E+ NE Sbjct: 45 TLLISKIREEYPDRIMNTYSVVPSPKVSDTVVEPYNATLS-IHQLVENTDETYC-IDNEA 102 Query: 693 IYDIC 707 +YDIC Sbjct: 103 LYDIC 107 >AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase protein. Length = 1248 Score = 27.1 bits (57), Expect(2) = 0.056 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +3 Query: 171 CPQTRPSGVETILSTLSSARPELASTYPCCLR 266 C RPS ++ ++ S RP+LA+ C R Sbjct: 164 CGSARPSRIDVAFASPSICRPDLAANSATCWR 195 Score = 21.8 bits (44), Expect(2) = 0.056 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = +3 Query: 114 VMPAGSFTAWSTASSLMARCPQTRPSGV 197 V+ AG F AW TA +T+P G+ Sbjct: 116 VLLAGDFNAWHTAWG----SERTKPKGI 139 >AY390608-1|AAR27305.1| 242|Anopheles gambiae SP22D protein. Length = 242 Score = 27.1 bits (57), Expect = 0.58 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = -1 Query: 309 CASADLINNSRFKIDEDSRGTCLPAPVSLKKVLKESSPPPMVLS 178 CA L N + + D S+ +CLP P SL V + ++ P L+ Sbjct: 142 CAPGTLFNPNTRECDHPSKVSCLPVP-SLNSVNEPANRAPPKLA 184 >AY390607-1|AAR27304.1| 242|Anopheles gambiae SP22D protein. Length = 242 Score = 27.1 bits (57), Expect = 0.58 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = -1 Query: 309 CASADLINNSRFKIDEDSRGTCLPAPVSLKKVLKESSPPPMVLS 178 CA L N + + D S+ +CLP P SL V + ++ P L+ Sbjct: 142 CAPGTLFNPNTRECDHPSKVSCLPVP-SLNSVNEPANRAPPKLA 184 >AY390606-1|AAR27303.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 27.1 bits (57), Expect = 0.58 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = -1 Query: 309 CASADLINNSRFKIDEDSRGTCLPAPVSLKKVLKESSPPPMVLS 178 CA L N + + D S+ +CLP P SL V + ++ P L+ Sbjct: 141 CAPGTLFNPNTRECDHPSKVSCLPVP-SLNSVNEPANRAPPKLA 183 >AY390605-1|AAR27302.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 27.1 bits (57), Expect = 0.58 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = -1 Query: 309 CASADLINNSRFKIDEDSRGTCLPAPVSLKKVLKESSPPPMVLS 178 CA L N + + D S+ +CLP P SL V + ++ P L+ Sbjct: 141 CAPGTLFNPNTRECDHPSKVSCLPVP-SLNSVNEPANRAPPKLA 183 >AY390604-1|AAR27301.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 27.1 bits (57), Expect = 0.58 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = -1 Query: 309 CASADLINNSRFKIDEDSRGTCLPAPVSLKKVLKESSPPPMVLS 178 CA L N + + D S+ +CLP P SL V + ++ P L+ Sbjct: 141 CAPGTLFNPNTRECDHPSKVSCLPVP-SLNSVNEPANRAPPKLA 183 >AY390603-1|AAR27300.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 27.1 bits (57), Expect = 0.58 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = -1 Query: 309 CASADLINNSRFKIDEDSRGTCLPAPVSLKKVLKESSPPPMVLS 178 CA L N + + D S+ +CLP P SL V + ++ P L+ Sbjct: 141 CAPGTLFNPNTRECDHPSKVSCLPVP-SLNSVNEPANRAPPKLA 183 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 27.1 bits (57), Expect = 0.58 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = -1 Query: 309 CASADLINNSRFKIDEDSRGTCLPAPVSLKKVLKESSPPPMVLS 178 CA L N + + D S+ +CLP P SL V + ++ P L+ Sbjct: 213 CAPGTLFNPNTRECDHPSKVSCLPVP-SLNSVNEPANRAPPKLA 255 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 27.1 bits (57), Expect = 0.58 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = -1 Query: 309 CASADLINNSRFKIDEDSRGTCLPAPVSLKKVLKESSPPPMVLS 178 CA L N + + D S+ +CLP P SL V + ++ P L+ Sbjct: 212 CAPGTLFNPNTRECDHPSKVSCLPVP-SLNSVNEPANRAPPKLA 254 >AF515521-1|AAM61888.1| 233|Anopheles gambiae glutathione S-transferase u1 protein. Length = 233 Score = 25.4 bits (53), Expect = 1.8 Identities = 20/62 (32%), Positives = 27/62 (43%), Gaps = 2/62 (3%) Frame = +3 Query: 477 PLLRWRYRLWVTSLLMERLSVDYGKKSKLEFAIYPA--PQVSTAVVEPYNFLFSPPTQTL 650 P L R L ++ E +SVDYGK L A Y PQ V++ F S L Sbjct: 11 PSLAVRMALEALNIPYEHVSVDYGKAEHLT-AEYEKMNPQKEIPVLDDDGFFLSESNAIL 69 Query: 651 EH 656 ++ Sbjct: 70 QY 71 >EF117201-1|ABL67438.1| 481|Anopheles gambiae serpin 17 protein. Length = 481 Score = 24.6 bits (51), Expect = 3.1 Identities = 11/39 (28%), Positives = 20/39 (51%) Frame = -1 Query: 285 NSRFKIDEDSRGTCLPAPVSLKKVLKESSPPPMVLSVGI 169 + R I D +GT + SL V ++PPP +++ + Sbjct: 415 SQRTFISVDEQGTTAVSAASLAFVALSAAPPPPIINFAV 453 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 23.8 bits (49), Expect = 5.4 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +3 Query: 570 AIYPAPQVSTAVVEPYNFLFSPPTQ 644 A PAPQ S A V P + + +PP + Sbjct: 81 AASPAPQPSLAPVVPSSVVTAPPAR 105 >AY028784-1|AAK32958.2| 499|Anopheles gambiae cytochrome P450 protein. Length = 499 Score = 23.0 bits (47), Expect = 9.4 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +1 Query: 193 GWRRFFQHFLQRDRSWQAR 249 GW + HF QR R W R Sbjct: 12 GWLWIYLHFNQRYRFWVER 30 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 802,995 Number of Sequences: 2352 Number of extensions: 17216 Number of successful extensions: 46 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 40 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 46 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 72340815 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -