BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0474 (656 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase pro... 22 4.5 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 21 7.8 AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 21 7.8 >AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase protein. Length = 588 Score = 22.2 bits (45), Expect = 4.5 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -1 Query: 194 VLVTQTVSLANSPVFFLAIFLFTNFVSFFLR 102 ++V + S A + + IFL F+SFF R Sbjct: 558 IIVDSSTSGATIVNYSIMIFLSAVFISFFQR 588 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -3 Query: 588 PFTPVILKSLSSCT 547 PF P + KSL+S T Sbjct: 452 PFIPAVTKSLASLT 465 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 21.4 bits (43), Expect = 7.8 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +3 Query: 210 PTHSSSNETIEEDEDSNTP 266 P +SSNE E E ++TP Sbjct: 274 PASASSNEHEAESEHTSTP 292 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 168,492 Number of Sequences: 438 Number of extensions: 3506 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19734030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -