BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0470 (662 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_29786| Best HMM Match : I-set (HMM E-Value=0) 30 1.5 SB_45258| Best HMM Match : RhoGEF (HMM E-Value=2.4e-05) 28 7.8 >SB_29786| Best HMM Match : I-set (HMM E-Value=0) Length = 6300 Score = 30.3 bits (65), Expect = 1.5 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = +2 Query: 326 EKHLEALKKLANEDEFYSIKTTITTGE 406 ++HL A +KLA+ED+ Y T+ T E Sbjct: 659 QRHLRAAEKLADEDQSYRAAITVVTDE 685 >SB_45258| Best HMM Match : RhoGEF (HMM E-Value=2.4e-05) Length = 322 Score = 27.9 bits (59), Expect = 7.8 Identities = 20/77 (25%), Positives = 36/77 (46%) Frame = +3 Query: 18 VPFKFEIIYGCVFYLKIQLVIKFTNVVLISLNKLIIMQQFTLFFVVHLTALFASTACIDY 197 VPFK + + I + IKFTN+ + +II+ T ++ + +F +D Sbjct: 229 VPFKRLVRRSYNIVITITITIKFTNI-----DTIIIVINITNIIIILINIIFIRGIIVDI 283 Query: 198 DGFLNMKLEHSLNCNDE 248 +++ K H + NDE Sbjct: 284 --YIHCKHYHIHHFNDE 298 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,217,727 Number of Sequences: 59808 Number of extensions: 282351 Number of successful extensions: 667 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 633 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 667 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1705624125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -