BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0470 (662 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF364132-1|AAL35508.1| 397|Anopheles gambiae putative odorant r... 24 3.7 AJ439060-6|CAD27757.1| 297|Anopheles gambiae hypothetical prote... 24 4.9 >AF364132-1|AAL35508.1| 397|Anopheles gambiae putative odorant receptor Or4 protein. Length = 397 Score = 24.2 bits (50), Expect = 3.7 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -3 Query: 240 CNLKSVLVSCSKNHHNLY 187 CNLK + + CS H LY Sbjct: 204 CNLKVMTICCSIGHCTLY 221 >AJ439060-6|CAD27757.1| 297|Anopheles gambiae hypothetical protein protein. Length = 297 Score = 23.8 bits (49), Expect = 4.9 Identities = 9/33 (27%), Positives = 17/33 (51%) Frame = +3 Query: 117 LIIMQQFTLFFVVHLTALFASTACIDYDGFLNM 215 L I+ + L +V+ + + C D +GF+ M Sbjct: 28 LSIVDEIVLSYVISILEEASQDPCFDVEGFIEM 60 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 575,489 Number of Sequences: 2352 Number of extensions: 9697 Number of successful extensions: 59 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 59 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 59 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 66068490 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -