BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0469 (446 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monoo... 23 1.2 U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodops... 23 1.5 AB178034-1|BAD27112.1| 76|Apis mellifera apiceropsin protein. 23 1.5 AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic ac... 22 2.7 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 22 2.7 >DQ244074-1|ABB36784.1| 517|Apis mellifera cytochrome P450 monooxygenase protein. Length = 517 Score = 23.4 bits (48), Expect = 1.2 Identities = 14/35 (40%), Positives = 19/35 (54%), Gaps = 4/35 (11%) Frame = -2 Query: 337 RPPRP--RHAQNHRETR--TIPIVNERKQTTHDTR 245 RPP+ H + R R + +VNE+ QT HD R Sbjct: 126 RPPQEVISHYRRTRRDRYTNLGLVNEQGQTWHDLR 160 >U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodopsin protein. Length = 377 Score = 23.0 bits (47), Expect = 1.5 Identities = 6/13 (46%), Positives = 10/13 (76%) Frame = +3 Query: 282 IGMVRVSLWFWAW 320 + ++ +SLWF AW Sbjct: 279 VALMTISLWFMAW 291 >AB178034-1|BAD27112.1| 76|Apis mellifera apiceropsin protein. Length = 76 Score = 23.0 bits (47), Expect = 1.5 Identities = 6/13 (46%), Positives = 10/13 (76%) Frame = +3 Query: 282 IGMVRVSLWFWAW 320 + ++ +SLWF AW Sbjct: 29 VALMTISLWFMAW 41 >AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic acetylcholine receptorApisa2 subunit protein. Length = 541 Score = 22.2 bits (45), Expect = 2.7 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +3 Query: 93 LLLCRCQPLCSRTKPINIKLISV 161 ++LC L TKPI+++ SV Sbjct: 503 IILCEAPALRDNTKPIDMEYSSV 525 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 22.2 bits (45), Expect = 2.7 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = -3 Query: 138 LALCENRAAGIGIATSADYDIFVLKL 61 +A+ E G+A A YD VLKL Sbjct: 311 IAIKEKLVKDSGVAKDAAYDNIVLKL 336 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 96,098 Number of Sequences: 438 Number of extensions: 1689 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11697255 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -