BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0468 (678 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 23 2.3 AY052622-1|AAL15470.1| 290|Tribolium castaneum kynurenine 3-mon... 22 5.3 AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-mon... 22 5.3 AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-mon... 22 5.3 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 23.0 bits (47), Expect = 2.3 Identities = 15/39 (38%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = -2 Query: 620 NPMSNHLKMPDSKF-KCNILFIFNCNSIYGQTKYNIPTY 507 NPMS+HLK S F N F N ++K +I Y Sbjct: 350 NPMSHHLKQEPSGFTSSNHPFSINRLLPTAESKADIKMY 388 >AY052622-1|AAL15470.1| 290|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 290 Score = 21.8 bits (44), Expect = 5.3 Identities = 12/47 (25%), Positives = 22/47 (46%) Frame = +2 Query: 194 FS*TYVYVGSDILWDFVVQAPHTNPNQISLWSQDAYLVLAHISNSHN 334 +S TY+ G L P PN + +W + ++++A + N N Sbjct: 185 YSQTYIQHGYLELVIPPENGPKMTPNHLHIWPRGQFMMIA-LPNKDN 230 >AY052393-1|AAL15467.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 21.8 bits (44), Expect = 5.3 Identities = 12/47 (25%), Positives = 22/47 (46%) Frame = +2 Query: 194 FS*TYVYVGSDILWDFVVQAPHTNPNQISLWSQDAYLVLAHISNSHN 334 +S TY+ G L P PN + +W + ++++A + N N Sbjct: 185 YSQTYIQHGYLELVIPPENGPKMTPNHLHIWPRGQFMMIA-LPNKDN 230 >AY052391-1|AAL15465.1| 445|Tribolium castaneum kynurenine 3-monooxygenase protein. Length = 445 Score = 21.8 bits (44), Expect = 5.3 Identities = 12/47 (25%), Positives = 22/47 (46%) Frame = +2 Query: 194 FS*TYVYVGSDILWDFVVQAPHTNPNQISLWSQDAYLVLAHISNSHN 334 +S TY+ G L P PN + +W + ++++A + N N Sbjct: 185 YSQTYIQHGYLELVIPPENGPKMTPNHLHIWPRGQFMMIA-LPNKDN 230 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 156,418 Number of Sequences: 336 Number of extensions: 3378 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17697850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -