BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0468 (678 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_03_0097 + 15166077-15166349,15166623-15166694,15166715-151671... 30 1.5 02_05_0142 - 26227792-26228346,26228486-26228608,26229824-262300... 28 7.9 >02_03_0097 + 15166077-15166349,15166623-15166694,15166715-15167161, 15167579-15167794,15167873-15168213,15168329-15168947 Length = 655 Score = 30.3 bits (65), Expect = 1.5 Identities = 18/54 (33%), Positives = 25/54 (46%), Gaps = 1/54 (1%) Frame = -2 Query: 341 F*NCGCWKY-ELKLNRRLVTIERFDSGLCVAPEQQNPTRCQNLHIHRFKKTIKE 183 F +C W+Y E+ R + R L V P QQ P RC+ + K IK+ Sbjct: 527 FRDCFAWEYYEMPGLSRSIVEHRLPIKLGVRPHQQTPRRCKADMLEPVKAEIKQ 580 >02_05_0142 - 26227792-26228346,26228486-26228608,26229824-26230084, 26230658-26231116 Length = 465 Score = 27.9 bits (59), Expect = 7.9 Identities = 14/37 (37%), Positives = 21/37 (56%), Gaps = 2/37 (5%) Frame = -2 Query: 266 GLCVAPEQQNPTRCQNLHIHRF--KKTIKEHMCNKAY 162 G C A ++ P Q L ++ F KT+ +H+ NKAY Sbjct: 178 GYCAAQSERGP---QRLLVYEFMSNKTLDDHLFNKAY 211 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,208,557 Number of Sequences: 37544 Number of extensions: 265842 Number of successful extensions: 578 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 566 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 578 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1726796312 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -