BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0467 (665 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_24679| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.5 SB_59261| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.9 >SB_24679| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 335 Score = 28.7 bits (61), Expect = 4.5 Identities = 14/39 (35%), Positives = 18/39 (46%) Frame = +3 Query: 279 LIVVWANYDFRYC*MNLWYRITLNMSDFIFLKCCVGRFA 395 LI +W D R +NLW RIT I + RF+ Sbjct: 288 LIYIWKMQDVRQACLNLWRRITCRADRVIAINIEATRFS 326 >SB_59261| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 5445 Score = 28.3 bits (60), Expect = 5.9 Identities = 21/72 (29%), Positives = 34/72 (47%), Gaps = 11/72 (15%) Frame = +3 Query: 15 TGQSLGTHEKSFGNNKTNISKILLTQT*IDDLSIK-------VNQSSTTNY----CTCFS 161 TG++L + F ++ + K+LL T +D+ SI N++ Y C C + Sbjct: 912 TGKALKEVQTIFNKSRPLVPKVLLMITNVDECSIVPSKCGDIPNKNCVNVYGGFECVCVN 971 Query: 162 EVNFHENCSYDF 197 + F ENC Y F Sbjct: 972 D-TFGENCEYTF 982 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,330,012 Number of Sequences: 59808 Number of extensions: 398167 Number of successful extensions: 817 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 785 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 817 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1717720750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -