BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0467 (665 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81544-6|CAI46607.1| 376|Caenorhabditis elegans Hypothetical pr... 27 9.1 U23171-3|AAC46706.1| 1020|Caenorhabditis elegans Hypothetical pr... 27 9.1 >Z81544-6|CAI46607.1| 376|Caenorhabditis elegans Hypothetical protein F49C5.9 protein. Length = 376 Score = 27.5 bits (58), Expect = 9.1 Identities = 13/42 (30%), Positives = 24/42 (57%) Frame = -1 Query: 260 FFNPSLIKSEFYLFSDAQSLSKIVTTIFMKVNLTKTSAIICC 135 +F P+++ F L + SL ++ TT+F K+++ K I C Sbjct: 120 YFMPTMLLLSFGLIYNFMSLKQL-TTVFFKISIEKLLKRIIC 160 >U23171-3|AAC46706.1| 1020|Caenorhabditis elegans Hypothetical protein K02A2.3 protein. Length = 1020 Score = 27.5 bits (58), Expect = 9.1 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = -2 Query: 646 FCNSLLRYLDVRTHDLPGVTGLSAS 572 F NS + YLDV T DLP V + S Sbjct: 987 FNNSYMTYLDVLTEDLPRVLFIGGS 1011 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,724,377 Number of Sequences: 27780 Number of extensions: 300937 Number of successful extensions: 587 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 575 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 587 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1497472076 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -