BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0464 (694 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF543192-1|AAN40409.1| 636|Anopheles gambiae amino acid transpo... 27 0.56 U29486-1|AAC46995.1| 695|Anopheles gambiae ATP-binding-cassette... 25 2.3 U29485-1|AAC46994.1| 695|Anopheles gambiae ATP-binding-cassette... 25 2.3 U29484-1|AAC47423.1| 673|Anopheles gambiae ATP-binding-cassette... 25 2.3 AJ439353-5|CAD27927.1| 459|Anopheles gambiae putative G-protein... 23 6.9 >AF543192-1|AAN40409.1| 636|Anopheles gambiae amino acid transporter Ag_AAT8 protein. Length = 636 Score = 27.1 bits (57), Expect = 0.56 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = +2 Query: 356 LIQICCWFIQSKYSKPGTECLCKC*PYY*ASEYFL 460 +I IC + S Y PG +C+ K YY AS L Sbjct: 467 IIAICGVLLGSIYVTPGGQCVLKLVDYYGASSIAL 501 >U29486-1|AAC46995.1| 695|Anopheles gambiae ATP-binding-cassette protein protein. Length = 695 Score = 25.0 bits (52), Expect = 2.3 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = -1 Query: 433 RLALAETFSSRFGILALDEPTTNLDQENIHSLCAAL 326 RLA A + +L DEPT+ LD HS+ L Sbjct: 251 RLAFASETLTDPHLLLCDEPTSGLDSFMAHSVLQVL 286 >U29485-1|AAC46994.1| 695|Anopheles gambiae ATP-binding-cassette protein protein. Length = 695 Score = 25.0 bits (52), Expect = 2.3 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = -1 Query: 433 RLALAETFSSRFGILALDEPTTNLDQENIHSLCAAL 326 RLA A + +L DEPT+ LD HS+ L Sbjct: 251 RLAFASETLTDPHLLLCDEPTSGLDSFMAHSVLQVL 286 >U29484-1|AAC47423.1| 673|Anopheles gambiae ATP-binding-cassette protein protein. Length = 673 Score = 25.0 bits (52), Expect = 2.3 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = -1 Query: 433 RLALAETFSSRFGILALDEPTTNLDQENIHSLCAAL 326 RLA A + +L DEPT+ LD HS+ L Sbjct: 229 RLAFASETLTDPHLLLCDEPTSGLDSFMAHSVLQVL 264 >AJ439353-5|CAD27927.1| 459|Anopheles gambiae putative G-protein coupled receptor protein. Length = 459 Score = 23.4 bits (48), Expect = 6.9 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +3 Query: 588 YHYLCISFAKVP**SCWIFSI 650 Y YL + K+P SCW+ I Sbjct: 223 YAYLFFAVGKLPSCSCWVVRI 243 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 731,290 Number of Sequences: 2352 Number of extensions: 14616 Number of successful extensions: 16 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 70250040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -