BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0464 (694 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex det... 22 4.8 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 22 6.4 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 22 6.4 DQ435326-1|ABD92641.1| 132|Apis mellifera OBP9 protein. 22 6.4 AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 22 6.4 DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chlor... 21 8.4 >DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 22.2 bits (45), Expect = 4.8 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -2 Query: 135 HSLNTYKFYFNNK 97 H+ N YK+ +NNK Sbjct: 91 HNNNNYKYNYNNK 103 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 21.8 bits (44), Expect = 6.4 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = -2 Query: 423 LQRHSVPGLEYLLWMNQQQIW 361 L R + P L + W N+ Q W Sbjct: 44 LYRVAQPALANITWYNEGQAW 64 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 21.8 bits (44), Expect = 6.4 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = -2 Query: 423 LQRHSVPGLEYLLWMNQQQIW 361 L R + P L + W N+ Q W Sbjct: 44 LYRVAQPALANITWYNEGQAW 64 >DQ435326-1|ABD92641.1| 132|Apis mellifera OBP9 protein. Length = 132 Score = 21.8 bits (44), Expect = 6.4 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -1 Query: 694 AVALNKCLMEFHREKMENI 638 A L KC +EFH E ++ + Sbjct: 111 AYQLVKCYVEFHPEVLQTV 129 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 21.8 bits (44), Expect = 6.4 Identities = 10/47 (21%), Positives = 24/47 (51%) Frame = +2 Query: 542 DSTVKLPSVLISM*SISLPLYIFRQSSLIIMLDIFHFLSMKLHKTFI 682 D+ KLP I++ +S+P+ + R+ + + ++ +L F+ Sbjct: 55 DTESKLPVKAITLPDLSIPMQLGRRQPFSLFIPAHRKIAARLIDIFM 101 >DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chloride channel protein. Length = 383 Score = 21.4 bits (43), Expect = 8.4 Identities = 8/29 (27%), Positives = 17/29 (58%) Frame = -2 Query: 663 FIERKWKISNMIIRELWRKIYRGNDIDYI 577 F+ + W+ S + + E + YR D+D++ Sbjct: 56 FLAQSWRDSRLRLPENMSEDYRILDVDWL 84 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 194,215 Number of Sequences: 438 Number of extensions: 4143 Number of successful extensions: 12 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21195810 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -