BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0463 (658 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. 24 0.96 AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless pr... 24 0.96 >DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. Length = 305 Score = 24.2 bits (50), Expect = 0.96 Identities = 9/32 (28%), Positives = 21/32 (65%) Frame = +2 Query: 344 TSDRESSRYGIVQQASIDSTDSRICYLTSSEI 439 TSDR+ S+YG++ + ++++ + Y + + I Sbjct: 62 TSDRDRSKYGMLARLAVEAGFDWVYYESRAHI 93 >AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless protein. Length = 325 Score = 24.2 bits (50), Expect = 0.96 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = -2 Query: 192 QRRASRPSVYTRPRGPTRQYTTRTEM 115 +RRA+RP V T PR + ++ T M Sbjct: 41 RRRAARPGVVTTPRWGCARASSATTM 66 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 141,634 Number of Sequences: 336 Number of extensions: 2754 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16969115 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -