BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0463 (658 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF387862-2|AAL56548.1| 942|Anopheles gambiae pol polyprotein pr... 25 1.6 AF387858-1|AAL58708.1| 209|Anopheles gambiae integrase protein. 25 1.6 AF387857-1|AAL58707.1| 215|Anopheles gambiae integrase protein. 25 1.6 AF387850-1|AAL58705.1| 209|Anopheles gambiae integrase protein. 25 1.6 EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc... 24 4.9 DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 24 4.9 AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 24 4.9 CR954256-3|CAJ14144.1| 659|Anopheles gambiae cyclin protein. 23 6.4 AY280612-1|AAQ21365.1| 309|Anopheles gambiae carbonic anhydrase... 23 6.4 AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 23 8.5 >AF387862-2|AAL56548.1| 942|Anopheles gambiae pol polyprotein protein. Length = 942 Score = 25.4 bits (53), Expect = 1.6 Identities = 13/45 (28%), Positives = 20/45 (44%) Frame = +2 Query: 314 DRQDSVRSEYTSDRESSRYGIVQQASIDSTDSRICYLTSSEISDD 448 D D V S+ E S + + + TDS +C T+ + DD Sbjct: 333 DFDDDVGDRLESEEEDSTDETLIEEELTDTDSSMCDSTNEDDGDD 377 >AF387858-1|AAL58708.1| 209|Anopheles gambiae integrase protein. Length = 209 Score = 25.4 bits (53), Expect = 1.6 Identities = 13/45 (28%), Positives = 20/45 (44%) Frame = +2 Query: 314 DRQDSVRSEYTSDRESSRYGIVQQASIDSTDSRICYLTSSEISDD 448 D D V S+ E S + + + TDS +C T+ + DD Sbjct: 103 DFDDDVGDRLESEEEDSTDETLIEEELTDTDSSMCDSTNEDDGDD 147 >AF387857-1|AAL58707.1| 215|Anopheles gambiae integrase protein. Length = 215 Score = 25.4 bits (53), Expect = 1.6 Identities = 13/45 (28%), Positives = 20/45 (44%) Frame = +2 Query: 314 DRQDSVRSEYTSDRESSRYGIVQQASIDSTDSRICYLTSSEISDD 448 D D V S+ E S + + + TDS +C T+ + DD Sbjct: 109 DFDDDVGDRLESEEEDSTDETLIEEELTDTDSSMCDSTNEDDGDD 153 >AF387850-1|AAL58705.1| 209|Anopheles gambiae integrase protein. Length = 209 Score = 25.4 bits (53), Expect = 1.6 Identities = 13/45 (28%), Positives = 20/45 (44%) Frame = +2 Query: 314 DRQDSVRSEYTSDRESSRYGIVQQASIDSTDSRICYLTSSEISDD 448 D D V S+ E S + + + TDS +C T+ + DD Sbjct: 103 DFDDDVGDRLESEEEDSTDETLIEEELTDTDSSMCDSTNEDDGDD 147 >EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium channel alpha2-delta subunit 1 protein. Length = 1256 Score = 23.8 bits (49), Expect = 4.9 Identities = 13/50 (26%), Positives = 27/50 (54%) Frame = -1 Query: 403 GTVDGSLLHDPVARRLPVTCVFGAHTVLPIKHTPLFEAVRSVAPIAGVVE 254 GT+ SL+ D + RR+P+ G + +T E ++ V P++ +++ Sbjct: 981 GTIMDSLVQDRIYRRVPLMDYQGICSDRDNPYTGAGEPLKPVRPMSWLLQ 1030 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 23.8 bits (49), Expect = 4.9 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +3 Query: 21 DRGYLSDHNTRDRVRDRDQGYLSDHQS 101 D+ L+ T +RDR GY S H+S Sbjct: 965 DQSLLTMETTTTIIRDRVSGYSSLHES 991 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 23.8 bits (49), Expect = 4.9 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = -2 Query: 210 GGGPAVQRRASRPSVYTRPRG 148 GG P + RP+ Y RP G Sbjct: 306 GGAPGGPPQGMRPNFYNRPMG 326 >CR954256-3|CAJ14144.1| 659|Anopheles gambiae cyclin protein. Length = 659 Score = 23.4 bits (48), Expect = 6.4 Identities = 8/16 (50%), Positives = 13/16 (81%) Frame = +3 Query: 30 YLSDHNTRDRVRDRDQ 77 ++ +H+ RDR RDRD+ Sbjct: 577 FVVEHSRRDRDRDRDR 592 >AY280612-1|AAQ21365.1| 309|Anopheles gambiae carbonic anhydrase protein. Length = 309 Score = 23.4 bits (48), Expect = 6.4 Identities = 13/24 (54%), Positives = 16/24 (66%), Gaps = 5/24 (20%) Frame = +3 Query: 213 SPWDSLPS-----LRHEGSSTTPA 269 SP++ LPS R+EGS TTPA Sbjct: 197 SPYNLLPSNRTSFYRYEGSLTTPA 220 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 23.0 bits (47), Expect = 8.5 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +3 Query: 540 NRSIFQLHRRSQEGRIPKR 596 N +I + R +EGR+P+R Sbjct: 886 NTTIEDIRRMDEEGRLPRR 904 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 683,436 Number of Sequences: 2352 Number of extensions: 14220 Number of successful extensions: 62 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 60 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 62 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 65232180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -