BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0456 (295 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_O49456 Cluster: Putative uncharacterized protein F20O9.... 32 2.8 >UniRef50_O49456 Cluster: Putative uncharacterized protein F20O9.150; n=1; Arabidopsis thaliana|Rep: Putative uncharacterized protein F20O9.150 - Arabidopsis thaliana (Mouse-ear cress) Length = 1103 Score = 31.9 bits (69), Expect = 2.8 Identities = 24/91 (26%), Positives = 41/91 (45%), Gaps = 2/91 (2%) Frame = -1 Query: 268 IYIVYLGPVGAHRHHQRKCRYAPREMSSQFYS--TMIALPFKLKRMVPIYXXXXXXXXSI 95 + IV GAHR R C Y ++SQ + T +A+P L +V + I Sbjct: 838 VLIVLSHNAGAHR--SRVCAYGKGSLNSQSFPLRTALAMPTALAGIVTLLHACLDMKSII 895 Query: 94 LKVDR*LLVFISVSSQPEQLLSMPARIYLVS 2 L +L F+ ++ QP +L++ + +S Sbjct: 896 LGKYHYVLYFLVLAMQPRMMLTVDQSLKPIS 926 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 255,849,942 Number of Sequences: 1657284 Number of extensions: 3750610 Number of successful extensions: 6545 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 6465 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6543 length of database: 575,637,011 effective HSP length: 75 effective length of database: 451,340,711 effective search space used: 9929495642 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -