BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0456 (295 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17106| Best HMM Match : FYVE (HMM E-Value=5e-17) 26 6.0 SB_35563| Best HMM Match : Keratin_B2 (HMM E-Value=3.3) 25 8.0 >SB_17106| Best HMM Match : FYVE (HMM E-Value=5e-17) Length = 289 Score = 25.8 bits (54), Expect = 6.0 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 244 VGAHRHHQRKCRYAPREMSSQFYSTMIALPFK 149 VG +HH RKC A + S+ ST+ + F+ Sbjct: 195 VGVRQHHCRKCGRAVCQSCSEKQSTLPIMGFE 226 >SB_35563| Best HMM Match : Keratin_B2 (HMM E-Value=3.3) Length = 138 Score = 25.4 bits (53), Expect = 8.0 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -2 Query: 162 PYPLN*NAWYLSILLP 115 PYPL N YL+++LP Sbjct: 9 PYPLRRNGGYLNVILP 24 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,909,140 Number of Sequences: 59808 Number of extensions: 117376 Number of successful extensions: 253 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 243 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 253 length of database: 16,821,457 effective HSP length: 71 effective length of database: 12,575,089 effective search space used: 326952314 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -