BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0453 (520 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value L01588-1|AAA27735.1| 74|Apis mellifera zinc finger protein pro... 26 0.27 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 21 5.7 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 21 5.7 >L01588-1|AAA27735.1| 74|Apis mellifera zinc finger protein protein. Length = 74 Score = 25.8 bits (54), Expect = 0.27 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = -1 Query: 520 KPLPLHTAHDRSRRDVHLLTRHRCHNIRRHRYGSH 416 KP H R RD HL T R H + + SH Sbjct: 8 KPFECPECHKRFTRDHHLKTHMRLHTGEKPYHCSH 42 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 21.4 bits (43), Expect = 5.7 Identities = 7/18 (38%), Positives = 13/18 (72%) Frame = +3 Query: 45 LHLSPYITQCNPLSSRLW 98 L++SP ++ N +SR+W Sbjct: 620 LYVSPVSSEYNQYNSRIW 637 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 21.4 bits (43), Expect = 5.7 Identities = 7/18 (38%), Positives = 13/18 (72%) Frame = +3 Query: 45 LHLSPYITQCNPLSSRLW 98 L++SP ++ N +SR+W Sbjct: 620 LYVSPVSSEYNQYNSRIW 637 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 132,175 Number of Sequences: 438 Number of extensions: 2657 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14477538 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -