BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0450 (710 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_0095 + 733307-734060,734779-734802,735029-736098 28 6.4 >01_01_0095 + 733307-734060,734779-734802,735029-736098 Length = 615 Score = 28.3 bits (60), Expect = 6.4 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = -1 Query: 464 YRKCRCELYRSSPGSRCLLASFVQIPSASGTKD 366 Y RC LY + PG + + S V PS S T D Sbjct: 106 YHSSRCSLYNAQPG-KIVCCSKVLTPSMSPTND 137 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,145,677 Number of Sequences: 37544 Number of extensions: 323075 Number of successful extensions: 583 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 575 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 583 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1839213168 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -