BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0449 (699 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_01_0498 + 4152729-4152820,4153316-4153425,4153840-4153877,415... 30 2.0 05_01_0231 - 1730428-1730817 29 3.5 05_01_0582 - 5220614-5220781,5220866-5220930,5221149-5221332 28 8.2 >05_01_0498 + 4152729-4152820,4153316-4153425,4153840-4153877, 4154335-4154433,4154461-4157475 Length = 1117 Score = 29.9 bits (64), Expect = 2.0 Identities = 16/46 (34%), Positives = 27/46 (58%), Gaps = 2/46 (4%) Frame = +3 Query: 396 HNLGNIVDQL--CTSLQDIKDHEDSVIGMPTCSIEQAEAVVNITLH 527 ++LG +D L CTSL+ I +S+ G +I++ +VN+ LH Sbjct: 485 NDLGGSIDALLSCTSLKSIDVSNNSLTGEIPPAIDRLPGLVNLALH 530 >05_01_0231 - 1730428-1730817 Length = 129 Score = 29.1 bits (62), Expect = 3.5 Identities = 17/48 (35%), Positives = 25/48 (52%) Frame = +3 Query: 309 GDSLRACHVKITSTHSTLHHLIPTVCIQEHNLGNIVDQLCTSLQDIKD 452 GD R C K+ + LH L+ V +H G I+ + +SLQ+I D Sbjct: 80 GDRNRLCGEKLKKRY--LHELLRDVEPDDHKHGGILQRCKSSLQEIVD 125 >05_01_0582 - 5220614-5220781,5220866-5220930,5221149-5221332 Length = 138 Score = 27.9 bits (59), Expect = 8.2 Identities = 15/45 (33%), Positives = 20/45 (44%) Frame = +2 Query: 446 KRSRRFCHRYANVFYRTSRGCRQYYAAFPALKKGQESPLQYYLPP 580 KR +RF H Y N + + C A P KK P + + PP Sbjct: 72 KRGKRFNHSYGNTCHLLTAVCSS--QARPRNKKKGTGPARLFAPP 114 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,112,192 Number of Sequences: 37544 Number of extensions: 392214 Number of successful extensions: 834 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 817 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 834 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1792053856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -