BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0448 (718 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0232 + 6614784-6614882,6616145-6616477,6616708-6616967,661... 29 2.8 02_05_1218 - 35007536-35007658,35007868-35008101 28 8.5 >03_02_0232 + 6614784-6614882,6616145-6616477,6616708-6616967, 6617328-6617469,6617567-6617938,6618056-6618187, 6618907-6619035,6619125-6621188 Length = 1176 Score = 29.5 bits (63), Expect = 2.8 Identities = 12/24 (50%), Positives = 16/24 (66%), Gaps = 2/24 (8%) Frame = -2 Query: 261 PLTQTAPTFSIF--SPPYRRDLHQ 196 P+ +T P+F + SPPYR LHQ Sbjct: 1046 PIRKTTPSFRVMHTSPPYRNGLHQ 1069 >02_05_1218 - 35007536-35007658,35007868-35008101 Length = 118 Score = 27.9 bits (59), Expect = 8.5 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +1 Query: 235 ERWRRLCERRMPSMFRAGVAAHSPHTSIHTT*LPMG 342 +RWR + E + S A VAA P +S+H+ +G Sbjct: 14 QRWRVIVETSIASSAAAAVAAGLPASSVHSNKARLG 49 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,386,276 Number of Sequences: 37544 Number of extensions: 365911 Number of successful extensions: 811 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 792 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 811 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1862792824 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -