BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0447 (253 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q96Q91 Cluster: Anion exchange protein 4; n=21; Amniota... 31 4.9 UniRef50_Q9P2E8 Cluster: E3 ubiquitin-protein ligase MARCH4 prec... 30 8.5 >UniRef50_Q96Q91 Cluster: Anion exchange protein 4; n=21; Amniota|Rep: Anion exchange protein 4 - Homo sapiens (Human) Length = 983 Score = 31.1 bits (67), Expect = 4.9 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 128 RQTMHPRGPDLHSVYDVTLITILSYL 205 RQ HPRGP H+V D+ ++L +L Sbjct: 611 RQGGHPRGPGCHTVPDIAFFSLLLFL 636 >UniRef50_Q9P2E8 Cluster: E3 ubiquitin-protein ligase MARCH4 precursor; n=43; Euteleostomi|Rep: E3 ubiquitin-protein ligase MARCH4 precursor - Homo sapiens (Human) Length = 410 Score = 30.3 bits (65), Expect = 8.5 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = +2 Query: 89 EITKNP*SSAGPARQTMHPRGPDLHSVYDVTLITILSYLQLNKWR 223 E P GPA+ HP GP H T++ ILS+L+ ++ R Sbjct: 350 ETAGTPAPEQGPAQAAGHPSGPLSHHHCAYTILHILSHLRPHEQR 394 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 235,561,685 Number of Sequences: 1657284 Number of extensions: 3697003 Number of successful extensions: 5102 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5052 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5102 length of database: 575,637,011 effective HSP length: 62 effective length of database: 472,885,403 effective search space used: 9930593463 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -