BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0441 (498 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0460 - 8654283-8654302,8654669-8654847,8654940-8655125,865... 29 2.7 04_01_0581 + 7555323-7555383,7555640-7555727,7556063-7557047 28 3.6 07_01_0574 + 4252087-4253973 27 6.3 04_03_0212 + 12697854-12698549,12698655-12698930,12698991-126990... 27 8.4 >03_02_0460 - 8654283-8654302,8654669-8654847,8654940-8655125, 8655626-8655781,8656223-8656431,8657254-8657358 Length = 284 Score = 28.7 bits (61), Expect = 2.7 Identities = 11/23 (47%), Positives = 17/23 (73%), Gaps = 1/23 (4%) Frame = +3 Query: 57 PNPLFFIYFTMLL-LHINYLYWW 122 P L++I+ TMLL L + ++YWW Sbjct: 233 PTTLYYIFNTMLLTLLVFHIYWW 255 >04_01_0581 + 7555323-7555383,7555640-7555727,7556063-7557047 Length = 377 Score = 28.3 bits (60), Expect = 3.6 Identities = 22/88 (25%), Positives = 40/88 (45%), Gaps = 2/88 (2%) Frame = +3 Query: 135 RVLTGRYHPAYFCFEAKTRFGLKNSCLQVGDGIYAVDVYGSLPLNTRWAASAFIHLSYKK 314 RVL G AY ++ F L LQ GD + + ++ WA +HL ++ Sbjct: 91 RVLRGLLWLAYLSADSVAVFVLGRLTLQTGDPRHQLTIF--------WAPFLLLHLGGQE 142 Query: 315 YITSFCLD--AFYLPECINIITHLMIPI 392 I++F ++ A + +N++T + I Sbjct: 143 TISAFSMEDSALWKRHVLNLLTQSTLAI 170 >07_01_0574 + 4252087-4253973 Length = 628 Score = 27.5 bits (58), Expect = 6.3 Identities = 13/47 (27%), Positives = 26/47 (55%), Gaps = 2/47 (4%) Frame = +3 Query: 258 LPLNTRWAASAFIHLSYKKYITSFCLD--AFYLPECINIITHLMIPI 392 LPL+ WA IHL + IT+F ++ +L +N++ +++ + Sbjct: 78 LPLSFFWAPFFLIHLGGQDTITAFAMEDNDLWLRHFLNLVVQVVLAV 124 >04_03_0212 + 12697854-12698549,12698655-12698930,12698991-12699038, 12699659-12699715,12700965-12701163,12702267-12702373, 12702586-12702759,12702844-12703083,12703638-12703693, 12704499-12704622 Length = 658 Score = 27.1 bits (57), Expect = 8.4 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +3 Query: 93 LLHINYLYWW*EYLRV 140 L H+NYLYW +YL + Sbjct: 535 LFHVNYLYWLEKYLGI 550 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,067,334 Number of Sequences: 37544 Number of extensions: 251583 Number of successful extensions: 482 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 466 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 482 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1047416480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -