BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0441 (498 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33401| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 27 6.5 SB_43616| Best HMM Match : FeS (HMM E-Value=8.7) 27 8.6 >SB_33401| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 4277 Score = 27.5 bits (58), Expect = 6.5 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +1 Query: 202 RTHVSRWVTAFML*MSMDRYHLTPGGPRARSSI 300 R +S+WVT + L S+D H R R+ I Sbjct: 3642 RQDISQWVTGYYLSYSLDGVHFAVYAQRGRTKI 3674 >SB_43616| Best HMM Match : FeS (HMM E-Value=8.7) Length = 90 Score = 27.1 bits (57), Expect = 8.6 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +3 Query: 15 NVGSIPWTPRAASKPNPLF 71 N+G +PW P+A S P F Sbjct: 72 NLGGLPWVPKAPSFPGKAF 90 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,456,518 Number of Sequences: 59808 Number of extensions: 307496 Number of successful extensions: 528 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 491 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 528 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1075029208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -