Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0441
         (498 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

D79208-1|BAA11466.1|  567|Apis mellifera alpha-glucosidase protein.    23   1.8  
AB253417-1|BAE86928.1|  567|Apis mellifera alpha-glucosidase pro...    23   1.8  
AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.              21   5.4  
AB231585-1|BAE17127.1|  898|Apis mellifera Mahya protein.              21   5.4  

>D79208-1|BAA11466.1|  567|Apis mellifera alpha-glucosidase protein.
          Length = 567

 Score = 23.0 bits (47), Expect = 1.8
 Identities = 7/10 (70%), Positives = 8/10 (80%)
 Frame = +2

Query: 20  WEHTVDPKGC 49
           WE T DP+GC
Sbjct: 392 WEDTQDPQGC 401


>AB253417-1|BAE86928.1|  567|Apis mellifera alpha-glucosidase
           protein.
          Length = 567

 Score = 23.0 bits (47), Expect = 1.8
 Identities = 7/10 (70%), Positives = 8/10 (80%)
 Frame = +2

Query: 20  WEHTVDPKGC 49
           WE T DP+GC
Sbjct: 392 WEDTQDPQGC 401


>AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.
          Length = 1946

 Score = 21.4 bits (43), Expect = 5.4
 Identities = 7/10 (70%), Positives = 8/10 (80%)
 Frame = +3

Query: 252 GSLPLNTRWA 281
           G LPLN RW+
Sbjct: 610 GDLPLNIRWS 619


>AB231585-1|BAE17127.1|  898|Apis mellifera Mahya protein.
          Length = 898

 Score = 21.4 bits (43), Expect = 5.4
 Identities = 8/30 (26%), Positives = 13/30 (43%)
 Frame = +3

Query: 168 FCFEAKTRFGLKNSCLQVGDGIYAVDVYGS 257
           F F+ KT   + +  L      +  D+Y S
Sbjct: 779 FAFDVKTTLNISDIALYPSQTTHGYDIYAS 808


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 143,487
Number of Sequences: 438
Number of extensions: 2969
Number of successful extensions: 4
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 146,343
effective HSP length: 54
effective length of database: 122,691
effective search space used: 13618701
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)