BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0441 (498 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. 23 1.8 AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase pro... 23 1.8 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 21 5.4 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 21 5.4 >D79208-1|BAA11466.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 23.0 bits (47), Expect = 1.8 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +2 Query: 20 WEHTVDPKGC 49 WE T DP+GC Sbjct: 392 WEDTQDPQGC 401 >AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 23.0 bits (47), Expect = 1.8 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +2 Query: 20 WEHTVDPKGC 49 WE T DP+GC Sbjct: 392 WEDTQDPQGC 401 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.4 bits (43), Expect = 5.4 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +3 Query: 252 GSLPLNTRWA 281 G LPLN RW+ Sbjct: 610 GDLPLNIRWS 619 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 21.4 bits (43), Expect = 5.4 Identities = 8/30 (26%), Positives = 13/30 (43%) Frame = +3 Query: 168 FCFEAKTRFGLKNSCLQVGDGIYAVDVYGS 257 F F+ KT + + L + D+Y S Sbjct: 779 FAFDVKTTLNISDIALYPSQTTHGYDIYAS 808 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 143,487 Number of Sequences: 438 Number of extensions: 2969 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13618701 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -