BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0436 (684 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY330179-1|AAQ16285.1| 171|Anopheles gambiae odorant-binding pr... 24 3.9 AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro... 24 3.9 >AY330179-1|AAQ16285.1| 171|Anopheles gambiae odorant-binding protein AgamOBP53 protein. Length = 171 Score = 24.2 bits (50), Expect = 3.9 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = +2 Query: 323 LFIYLLVIKLFWLSITFKIPSFY*YEECEMFPIR*IC 433 LF+Y + + WL + F++P EE P R C Sbjct: 11 LFMYNIYYRALWLFLKFEVPHCCQMEELIPRPSRTKC 47 >AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein. Length = 2051 Score = 24.2 bits (50), Expect = 3.9 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -3 Query: 202 IGNAKRLSTFFYLFAS 155 +G KR STF+YL +S Sbjct: 928 MGGLKRFSTFYYLISS 943 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 615,641 Number of Sequences: 2352 Number of extensions: 11139 Number of successful extensions: 20 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 68995575 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -