Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0436
         (684 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At5g57320.1 68418.m07160 villin, putative similar to villin 2 (V...    28   6.6  

>At5g57320.1 68418.m07160 villin, putative similar to villin 2 (VLN2)
            [Arabidopsis thaliana] GI:3415115, villin 3 (VLN3)
            [Arabidopsis thaliana] GI:3415117; contains Pfam profiles
            PF00626: Gelsolin repeat, PF02209: Villin headpiece
            domain
          Length = 962

 Score = 27.9 bits (59), Expect = 6.6
 Identities = 16/44 (36%), Positives = 23/44 (52%)
 Frame = +3

Query: 60   VDKQKRNWYLAVL*FKKTFPIVFNCYYKARE*LANK*KKVLNRF 191
            VD  +R  YL  + FK+ F +  N +YK  +   NK K  +N F
Sbjct: 919  VDLTRREAYLTSVEFKEKFEMTKNEFYKLPKWKQNKLKMSVNLF 962


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,398,791
Number of Sequences: 28952
Number of extensions: 222426
Number of successful extensions: 371
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 366
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 371
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1447936096
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)