BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0435 (684 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_9363| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_11705| Best HMM Match : Cu2_monooxygen (HMM E-Value=1.8e-17) 28 8.1 SB_6617| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 >SB_9363| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 285 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +3 Query: 498 PLTIGGPVCSSATRAIKKRHVDRYHISH 581 PL++ GP+C AT A K R + Y SH Sbjct: 13 PLSVTGPLCMEATSAQKNRVLRGYGTSH 40 >SB_11705| Best HMM Match : Cu2_monooxygen (HMM E-Value=1.8e-17) Length = 413 Score = 27.9 bits (59), Expect = 8.1 Identities = 16/42 (38%), Positives = 20/42 (47%), Gaps = 3/42 (7%) Frame = -2 Query: 560 YMSFFYCPC--GRRAYGPTYG-EWLPSPVDFSNPRDRAKPLP 444 YM F+Y P G Y P +LP + P+D KPLP Sbjct: 265 YMMFYYDPEEEGDSKYDPESSCRYLPDSYPLNYPKDSDKPLP 306 >SB_6617| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 263 Score = 27.9 bits (59), Expect = 8.1 Identities = 15/48 (31%), Positives = 22/48 (45%) Frame = -3 Query: 556 CLFFIARVADEHTGPPMVSGYRRPWTSAIPETEPSRCLSLSTHHKPRL 413 CL I M S + +P+ ++I TEP CL+ T P+L Sbjct: 45 CLTIITSTDPRPCLTSMTSTHPQPYLTSITTTEPPLCLTSITSTDPQL 92 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,728,769 Number of Sequences: 59808 Number of extensions: 427667 Number of successful extensions: 947 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 837 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 947 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1769412099 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -