BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0435 (684 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ578202-1|CAE18203.1| 109|Homo sapiens immunoglobulin lambda-1... 31 3.8 >AJ578202-1|CAE18203.1| 109|Homo sapiens immunoglobulin lambda-1 variable region protein. Length = 109 Score = 31.1 bits (67), Expect = 3.8 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = -1 Query: 99 LKCDDKVSQLCCMIYLASTTYWLGSGSAVVV 7 L+ DD+ CC Y S+TY LG+G+ V V Sbjct: 80 LQADDEADYYCCS-YAGSSTYVLGTGTKVTV 109 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 95,944,446 Number of Sequences: 237096 Number of extensions: 1987324 Number of successful extensions: 3491 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 3358 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3490 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 7783251346 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -