BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0433 (587 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U02964-1|AAA03444.1| 376|Anopheles gambiae actin 1D protein. 183 3e-48 U02933-1|AAA56882.1| 376|Anopheles gambiae actin 1D protein. 183 3e-48 U02930-1|AAA56881.1| 376|Anopheles gambiae actin 1D protein. 183 3e-48 CR954256-1|CAJ14142.1| 376|Anopheles gambiae actin protein. 167 3e-43 AJ439353-5|CAD27927.1| 459|Anopheles gambiae putative G-protein... 25 1.8 U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 24 4.2 AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. 23 7.3 AF203338-1|AAF19833.1| 113|Anopheles gambiae immune-responsive ... 23 9.7 >U02964-1|AAA03444.1| 376|Anopheles gambiae actin 1D protein. Length = 376 Score = 183 bits (446), Expect = 3e-48 Identities = 89/104 (85%), Positives = 91/104 (87%) Frame = -3 Query: 570 CGIPETTYNFHHEVQREHP*GLYANPVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIA 391 CGI ETTYN + + LYAN VLSGGTTMYPGIADRMQKEITALAPSTMKIKIIA Sbjct: 273 CGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIA 332 Query: 390 PPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHSKCF 259 PPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVH KCF Sbjct: 333 PPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376 >U02933-1|AAA56882.1| 376|Anopheles gambiae actin 1D protein. Length = 376 Score = 183 bits (446), Expect = 3e-48 Identities = 89/104 (85%), Positives = 91/104 (87%) Frame = -3 Query: 570 CGIPETTYNFHHEVQREHP*GLYANPVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIA 391 CGI ETTYN + + LYAN VLSGGTTMYPGIADRMQKEITALAPSTMKIKIIA Sbjct: 273 CGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIA 332 Query: 390 PPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHSKCF 259 PPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVH KCF Sbjct: 333 PPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376 >U02930-1|AAA56881.1| 376|Anopheles gambiae actin 1D protein. Length = 376 Score = 183 bits (446), Expect = 3e-48 Identities = 89/104 (85%), Positives = 91/104 (87%) Frame = -3 Query: 570 CGIPETTYNFHHEVQREHP*GLYANPVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIA 391 CGI ETTYN + + LYAN VLSGGTTMYPGIADRMQKEITALAPSTMKIKIIA Sbjct: 273 CGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIA 332 Query: 390 PPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHSKCF 259 PPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVH KCF Sbjct: 333 PPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376 >CR954256-1|CAJ14142.1| 376|Anopheles gambiae actin protein. Length = 376 Score = 167 bits (405), Expect = 3e-43 Identities = 81/103 (78%), Positives = 84/103 (81%) Frame = -3 Query: 567 GIPETTYNFHHEVQREHP*GLYANPVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAP 388 GI ET YN + LYAN VLSGGTTMYPGIADRMQKEIT+LAPST+KIKIIAP Sbjct: 274 GIHETVYNSIMRCDVDIRKDLYANSVLSGGTTMYPGIADRMQKEITSLAPSTIKIKIIAP 333 Query: 387 PERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHSKCF 259 PERKYSVWIGGSILASLSTFQ MWISK EYDE GP IVH KCF Sbjct: 334 PERKYSVWIGGSILASLSTFQTMWISKHEYDEGGPGIVHRKCF 376 >AJ439353-5|CAD27927.1| 459|Anopheles gambiae putative G-protein coupled receptor protein. Length = 459 Score = 25.0 bits (52), Expect = 1.8 Identities = 12/36 (33%), Positives = 16/36 (44%) Frame = +2 Query: 218 PAAGCWRQRRAVL*KHLLCTMEGPDSSYSCFEIHIC 325 P+ CW R + + LCT P + C I IC Sbjct: 234 PSCSCWVVRIPIGKTYSLCTNSFPLGTLLCVGIVIC 269 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 23.8 bits (49), Expect = 4.2 Identities = 7/24 (29%), Positives = 15/24 (62%) Frame = +3 Query: 477 YHRTIRGWRTSLTDVHVALHDGSY 548 Y++ +RG RT + H+A+ + + Sbjct: 83 YYQNVRGLRTKTKEFHLAVSEADF 106 >AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. Length = 1356 Score = 23.0 bits (47), Expect = 7.3 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -2 Query: 355 IDPRLPLYLPTDVDLETGVRRVW 287 +DP + LYL T+ L+ G + W Sbjct: 1188 LDPDIRLYLKTNTYLQWGDKLFW 1210 >AF203338-1|AAF19833.1| 113|Anopheles gambiae immune-responsive trypsin-like serineprotease-related protein ISPR10 protein. Length = 113 Score = 22.6 bits (46), Expect = 9.7 Identities = 12/21 (57%), Positives = 13/21 (61%), Gaps = 2/21 (9%) Frame = -1 Query: 332 PSNRCGSRNRSTT--SLAPPL 276 P N+ GSRNR T LA PL Sbjct: 80 PGNKKGSRNRDTALLLLAEPL 100 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 589,865 Number of Sequences: 2352 Number of extensions: 12311 Number of successful extensions: 45 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 38 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 38 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 56347938 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -